KEGG   Pogona vitticeps (central bearded dragon): 110080387Help
Entry
110080387         CDS       T05000                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110080387 (SOD1)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110080387 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 110080387
NCBI-ProteinID: XP_020651896
LinkDB All DBs
Position
Unknown
AA seq 164 aa AA seqDB search
MAAQKTMAVQKAICVLVPDPTSGSQVKGVIHFEQKGSEVCVSGSIEGLTPGKHGFHVHEF
GDNTNGCTSAGPHFNPENKTHGGPDDEERHVGDLGNVTADALGVASVSKKDHVISLSGPH
SVIGRTMVVHAKEDDLGKGGNEESLKTGNAGARLACGVIGLAKA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagaaaacgatggcggtgcagaaagcgatttgcgtcctggtccctgacccg
acctccgggagtcaagtgaagggggtcattcatttcgagcagaagggtagtgaggtatgt
gtttcgggatctattgaaggactgactccagggaagcatgggttccatgtccatgagttt
ggagacaatactaatggatgtaccagtgcaggcccacacttcaatcctgagaacaaaaca
catggtggaccagatgatgaagaaaggcatgttggtgatcttggaaatgtgactgcagat
gcattaggtgtggcaagtgtatcaaaaaaggaccatgttatttctctctcggggccacat
tcagttattggacgtactatggtggttcatgcaaaagaagatgatctgggtaaaggtgga
aacgaagagagcttgaaaactggaaatgctggtgctcgtttagcttgtggtgtgattgga
ctggctaaggcttag

DBGET integrated database retrieval system