KEGG   Pogona vitticeps (central bearded dragon): 110080711Help
Entry
110080711         CDS       T05000                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial isoform X1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00020  Citrate cycle (TCA cycle)
pvt00310  Lysine degradation
pvt00380  Tryptophan metabolism
pvt01100  Metabolic pathways
pvt01200  Carbon metabolism
Module
pvt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pvt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pvt_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110080711 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    110080711 (OGDHL)
   00380 Tryptophan metabolism
    110080711 (OGDHL)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     110080711 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 110080711
NCBI-ProteinID: XP_020652494
LinkDB All DBs
Position
Unknown
AA seq 1018 aa AA seqDB search
MSHLRLIAASLKHRGICSLVKKNVDRKMLLPSRSYVSSGLTEPFLSGSNSSYIEEMYYAW
LENPKSVHKSWDLFFRNATAGALPGQAFQTSLPDISDGKTSLIQSHGLTQSPGKAEKLVE
DHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFIPSDLITTIDKLEFYGLDESDLDKV
FRLPTTTFIGGNETMLSLREIIKRLENTYCQHIGLEFMFINDVEQCDWIRQKFETPGVMK
FSSEEKRTLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIEHV
ILGMPHRGRLNVLANVIRKELEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRATNKK
ITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDTEGKKVMSILLHGDAAFAGQGVVYETFH
LSDLPSYTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMY
VCNVAAEWRNTFNKDVVIDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQIPVLKKYADKLI
ADGTVTLQEFEEEIAKYDKICEEAYTRSKDNKILHIKHWLDSPWPGFFNINGEPKSMTCP
STGIPEDTLNHIGNVASSVPLEGFQIHGGLSRILKGRLEMTKNRVVDWALGEYMAFGSLL
KEGIHVRLSGQDVERGTFSHRHHVLHDQDVDKRTCVPMNHLWEQQAPYTVCNSSLSEYGV
LGFELGFAMSSPNALVCWEAQFGDFQNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEG
MGPEHSSARPERFLQMSNDDPDAFPKFDNDFEVSQLFDCNWIVVNCSTPASYFHVLRRQI
LLPFRKPLIIFTPKSLLRHPEAKSSFDEMLLGTRFRRMIPEEGPPAESPSEVKRVIFCTG
KVYYDLVKERKNQDLEKEVAITRLEQISPFPFDLLKEEIEKYAKADLLWCQEEHKNMGFY
DYVKPRFRTIVNHTRPIWYVGREPAAAPATGNKNTHLVSLRRFLDTAFNLEAFEGKMF
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacttgcggctgattgctgctagcctgaaacatcgtggcatttgttctttggtg
aagaaaaatgtagacagaaaaatgcttctgccaagtcggagttatgtttcatcaggactc
acagaacctttcttgagtggaagtaattcaagttacatcgaagaaatgtattatgcgtgg
cttgaaaatccaaaaagtgtgcataagtcttgggatttgtttttccgaaatgctactgct
ggggctcttcctggacaagcctttcagacttctttacctgatatctcagatgggaaaaca
tcacttatccaaagccatgggctgactcagtcaccaggtaaagctgaaaaactggttgag
gatcacctggctgtgcagtcattgatcagagcatatcaaatccgtggacaccatgtggct
cagttggatcccttaggaatcttggatgccgacttggattcattcattccttcggattta
atcaccactatagataaactggagttttatggcttagatgaatcagacttggataaagtg
ttccggctgcctacaactacattcataggaggaaatgaaactatgctttctttacgagag
atcatcaagcgattggagaatacatattgtcaacacattggactggaatttatgtttata
aatgatgtggagcaatgtgattggatccggcagaagtttgagacaccaggtgtcatgaaa
ttcagcagtgaggaaaaaaggacattgttggctagactggtgcgatcaacaagatttgag
gattttcttgcccggaaatggtcatcagagaaacgttttggcttggaaggatgtgaagta
atgatccctgctcttaaaaccatcattgataaatctagtgaaatgggaattgagcatgtt
atattgggcatgcctcacagaggaaggctgaatgtgttggctaatgttatccgaaaggag
ctggaacagatcttttgccagtttgatccaaagctagaagcagctgatgaaggatctggt
gatgtaaaatatcacttaggaatgtaccacgagagaattaaccgtgcaacgaacaaaaag
atcaccctgtcacttgtggccaacccatctcatttggaagcagttgatcctgttgtacaa
ggaaagaccaaagctgagcagttttaccgaggcgatactgaggggaagaaggttatgtct
atacttttacatggtgatgccgccttcgctggacaaggagtagtttatgaaacctttcat
ctcagtgatcttccgtcatataccaccaatgggaccattcacgttgtggtcaacaatcag
attggttttactactgatccacgaatggctcgctcatctccatatccaacggatgtagct
cgggtagtgaatgcacctatttttcatgtgaatgctgatgatccagaagcagtaatgtat
gtgtgcaacgtagctgcagaatggcgaaacacttttaataaggatgttgttatagatttg
gtttgttaccgaagacgaggccacaatgaaatggatgaacccatgttcacccagcctttg
atgtacaagcagattcataaacagatccctgtgctgaaaaagtatgctgacaagttgata
gctgatggaactgtcacactacaggagtttgaggaggaaattgcaaaatatgataagata
tgtgaagaagcttatactagatctaaagataataaaattctacacattaaacactggctt
gattcaccttggccaggtttctttaatatcaatggagaaccaaagagtatgacttgtcct
tctacgggcattcctgaagatacgttgaaccatattggaaatgtagccagttctgtaccc
cttgaaggatttcagatacatggaggactttcccgaattttgaaaggtcgactggaaatg
acaaagaaccgagttgttgactgggccttaggagagtacatggcttttgggtctttactg
aaagaaggtatccatgttcggctaagtgggcaggatgtagaaagaggcactttcagccat
cgccaccatgtgctgcatgatcaagatgttgacaagaggacttgtgttcctatgaatcac
ctctgggaacaacaggctccctacactgtatgcaacagttctctttcagaatatggggtc
ttaggatttgagcttggctttgcaatgtcaagtcccaatgctctggtgtgctgggaagct
cagtttggtgactttcaaaatacagcacagtgtataattgatcagtttatcagctcagga
caggctaagtgggttcgtcacaacgggattgtcctacttttgcctcatggaatggaagga
atgggcccagaacattcttcagctagaccagagaggttccttcagatgagtaatgatgat
cctgatgctttcccaaaatttgataatgattttgaggtttcccagctctttgactgcaat
tggattgtggtgaactgttcaactccagccagttacttccatgtcctcagaagacagatc
ttattgccatttagaaagcctctaattatcttcacaccgaagtctttgctgagacatcct
gaagcaaaatccagctttgatgaaatgctattagggaccagatttaggcgtatgattcct
gaggaaggacccccagctgaaagtcctagtgaggtaaaacgagtgattttctgcactggg
aaggtttactatgaccttgttaaagaaaggaagaaccaggatttggagaaagaggtggct
ataaccagattggaacagatctcccctttcccttttgatttgctcaaagaggaaattgag
aagtatgccaaagctgatcttttgtggtgtcaagaagaacacaagaatatgggattttat
gattatgtcaagcctcgtttccgtaccattgtgaaccatactcgacctatatggtatgtt
ggccgtgaacctgctgctgctccagcaactggcaacaagaacactcatctggtgtcactc
agaagatttttagatacagctttcaacctggaggcatttgaaggaaaaatgttttga

DBGET integrated database retrieval system