KEGG   Pogona vitticeps (central bearded dragon): 110081369Help
Entry
110081369         CDS       T05000                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04210  Apoptosis
pvt04625  C-type lectin receptor signaling pathway
pvt04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110081369 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110081369 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110081369 (MAP3K14)
   04672 Intestinal immune network for IgA production
    110081369 (MAP3K14)
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     110081369 (MAP3K14)
Protein kinases [BR:pvt01001]
 Serine/threonine kinases: STE group
  Other
   110081369 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH FTA2
Motif
Other DBs
NCBI-GeneID: 110081369
NCBI-ProteinID: XP_020653659
LinkDB All DBs
Position
Unknown
AA seq 932 aa AA seqDB search
MAVMELVCQDTPAPGIGHLKEISAGKGPQEAANEKKSSICKVEDPEQMFQGPWKILNDVI
AKGTAKEDSGKGSLASISIIAQAECEISQEFSPTYSERPFIADTKKYSSQSFSLDQIPNN
VAHATEGKMAPVNRKTVHPGKSRKKRRKKRSHLMTSKGTSSLFQKPKTPEQESCIPVQED
DSHFSTFFNSTSWHSEPCKDLGHDFSCFKKPSKLLPTGQLHLLKNPTKLELHKLISPAQC
LSHVLKSHTLDNFAPQSEILHPFPSVQFSPYFHGCDNLHPAMKHSPLQTYLFDDLSRVNG
ESHLSDLSLEHSLSTCGHESAKTTSEKLSMEEFLVDALKGNVILGEPRNLACLAKTWKGL
SSKTCPQEMDENEGVLLVEKLKAVDYEYREDVHWTKCQSLLGTGSFGDVYKMEDKQTGFQ
CAAKKVRVEHFRAEELTTCTGMMHPKILPLYGAVKEGLWVTIFMKLMEGGSLGQLLKQRG
YLPEDRALDYLGQTLEGLEYLHACGVLHGDVKADNVLLSGDGNHTVLCDFGHAAHLHPDG
GGKYLVTGDYVPGTETHLAPEIVMGKRCDSKVDVWSSCCMMLHLLNGCHPWTQYYNHPLC
LKIAKEPPPLREIPPSSHPSTAHVIKAGLEKEPTKRASAAELRAKVYTALQQVGGLTSPW
RGEYREPRCLQVAQETSRPEPLLQEVEPPPSLKPLARSPGPPLPPQGWTERTQLTHPSMC
KKLLWPYDSLQPSMLTPLNSKKGSLTEWTTLEHDLQQLEFELILNSLSEPFSLEEQEQML
SCLSMEGSFPSDTSEKVSLKMSHSLKDTMSSGVHSWNSQIDGQSNSWNSWLQWSRQTDVP
TYFDGVKIEIHLLSGENLHIREFRGAKVGDVARGISSQIPASAFSFFTKEGQPVCCEMGI
PDSGIELQCTLAPDCSRGWAWRVKHGHLEKRP
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgatggaacttgtttgccaagacactccagccccaggcattgggcacctaaag
gagatttctgcaggcaaaggaccacaggaggcagcaaatgagaaaaagagcagcatttgc
aaagtagaggatccagagcaaatgttccaaggcccatggaagatcctgaatgatgtgatt
gccaaaggcactgccaaggaagacagtgggaaaggaagcttagcctcaatctctatcatc
gcccaagcagaatgtgagatcagccaggagttcagccccacctattcagagaggcctttt
attgctgacaccaagaaatacagcagccaatctttcagccttgaccagattcccaacaat
gtggctcatgcaactgaagggaaaatggctccagttaatcggaagaccgtgcatccaggt
aaatcccggaagaaacggcgaaagaaaagatcccacctaatgacatcaaagggaacatcc
tcactgtttcaaaagccaaagactccagagcaggagagctgcataccagtacaggaggat
gactctcactttagcactttcttcaacagcacttcatggcattcagagccatgtaaagat
ttgggccatgatttcagttgcttcaagaagcccagcaaactcttacctactggccagttg
cacttgctgaagaacccaaccaagctagaattacacaagttgatcagtcctgctcaatgc
ctgagccatgttttgaagtctcatactctggacaattttgcccctcagtcagagattcta
cacccattcccctctgtccagttttcaccttatttccacggctgtgacaacctacatcct
gccatgaaacatagccctctgcagacatatctgtttgatgatctttcacgtgttaatggt
gaaagtcacctgtcagatctgagtttggagcatagtttgtccacatgcggccatgaatct
gcaaaaaccacatcagagaagctgtctatggaagaatttctggtggatgccttgaaggga
aatgtaattcttggagaaccaagaaacttagcttgtttggccaagacatggaaaggactg
agttcgaagacatgccctcaagaaatggatgaaaatgaaggtgtgctgcttgtagagaaa
ctcaaagcagtggattatgaatatcgtgaagatgttcactggactaaatgtcagagcttg
cttggcacaggatcatttggggatgtgtacaaaatggaggacaagcagacgggctttcag
tgtgctgcaaaaaaggtgagagttgaacacttccgtgcagaggagttgacaacgtgtact
ggaatgatgcatcctaaaatcctgccattatatggagcagtgaaggaaggcctctgggtt
actattttcatgaagcttatggagggtgggtcacttggccagctgctcaagcagcgtggt
tatttgccagaagatagagcccttgattatctgggccaaacattagaaggcttggagtac
ctccatgcatgcggtgttctccatggagatgtaaaagctgacaatgtcctcttatctggt
gatggaaaccacactgtcctctgcgattttggtcatgcagctcacctccacccagatggt
ggggggaagtacttggtgactggggattatgttcctggcacagagacccacctggctcca
gaaattgtgatgggaaaacgctgtgattccaaggtagacgtttggagtagctgttgtatg
atgcttcacctcctgaatggctgccatccttggacccaatattataatcaccctctctgc
ctgaagatagccaaagagccacctcctctaagagaaattcccccctcctctcacccatcc
actgcccatgtcattaaagctggccttgagaaggagccaacaaagagagcctcagctgca
gaactgagagcaaaggtctacacagctctccagcaggttggaggcctgacaagcccctgg
agaggggaatatagagaacccagatgcctacaagtggcacaagaaacaagtcgcccagaa
ccactcttacaagaagttgagcctcctcctagcctgaagccattggccaggagccctggt
ccaccactccctcctcagggctggactgagagaacccaattaacccatcctagtatgtgc
aagaaattattatggccatatgactctcttcagccttctatgctgactccgctcaacagt
aagaagggcagcttgacagaatggacaaccttggaacatgaccttcagcagctggagttc
gagctgatcctaaacagcctctcagagcccttctctctggaggagcaggagcaaatgctc
tcgtgcctcagcatggaaggctccttcccatcagacaccagtgagaaggtctcattgaaa
atgtctcatagtctgaaggacacaatgagttcgggagtgcattcatggaacagccaaata
gatgggcagagcaacagctggaacagttggctacagtggagcaggcagacagacgtgccc
acctactttgacggggtaaagattgaaatccacttgcttagtggggagaacctgcacatc
agagaattccgtggggccaaggtgggggacgttgcaagaggaatcagtagtcagatacca
gcctcagcatttagcttcttcacaaaggaaggtcagccagtttgctgtgagatgggcatc
cctgattcgggcatcgaacttcagtgcactcttgcccctgactgcagccgtggctgggct
tggagggtcaaacatggtcacctggaaaagaggccataa

DBGET integrated database retrieval system