KEGG   Pogona vitticeps (central bearded dragon): 110081479Help
Entry
110081479         CDS       T05000                                 

Gene name
SETDB1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110081479 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pvt03036]
    110081479 (SETDB1)
Enzymes [BR:pvt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110081479 (SETDB1)
Chromosome and associated proteins [BR:pvt03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110081479 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110081479 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 YnfE
Motif
Other DBs
NCBI-GeneID: 110081479
NCBI-ProteinID: XP_020653844
LinkDB All DBs
Position
Unknown
AA seq 1293 aa AA seqDB search
MTLKGKGWVNLSLTCCDSERGEGASATMAESPEMMELQREVMEELGISLEDLRQLIEEEL
EKSESIKQRKQELESLEECVKQKEAEVAHVDQLLDSAVKAVDKCEVLVKDVYANLGLEYR
ETDSEEEIGSSKPTEVIEIPDEDDDDIMSIDSDANNKIAKDQSLLREAMAAMRKSAQDVQ
KFMDAVNKKSNSFDFQRGSQQLSPGCEITQDGDLAVGDRVLGKKRTKTWHKGTLIAIQNV
GPGKKYKVKFDNKGKSLLSGNHIAYDSHPHADKLHVGSRVVAKYKDGNQVWLYAGIVAET
PNIKNKMRFLIFFDDGYASYVIQPELYLICRPLKKSWEDIEDISCRDFIEEYITAYPNRP
MVLLKSGQQIKTEWDGTWWKSRVEEVDGSLVKILFLVGPAQDDKRCEWIYRGSTRLEPMF
SMKTSTASTLEKKQGGQMRTRPNVGAVRSKGPVVQYTQDLTGTSPQQQFKPVEQPPVPVA
VSQPVSPPQFIEVDSPDSQLSQAKKQQVAKKSTSFLRPGSVGSGPPSPSSPVPSETPPVG
RTGVTQQFRFSGAQPAGSPAQPFHNMLDQVPNEPSYRAPVEKLFYLPHVCSYTCLSRVRP
YCTDQYRSKNPLLIPLLYDFRRMTARRRINRKTGFHVIYKTPCGLCLRSMAEIERYLFET
ECDFLFLEMFCLDPYVLVDRKFQPYRPFYYILDITNGKEDVPLSCVNEIDNTPPPQVAYS
KERIPGNGVFINTRAEFLVGCDCEDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYK
RLEECLPTGVYECNKRCRCNRNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSF
VCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENSKEGYESEAKCSSDSSGVNLKDD
DDENTASEEPEESNEDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQRENGLSETASKDSG
LARQVSHEEAAPCKPPLSEETSKNKVASWLSSNTLADGFQDSDSRSSFRAQELPPPPAKA
EPAESERTGVAGKEEFIPEGDLKVKKKEVTGESEDHGKMSLVGNLGRLYGYNPNPTIPEG
VRRPVSKTALHQNRRQSDHPQPTKDDILMLSSSTDSEGDNGRGTSGQAPGNANDSDDIQT
ISSGSDLEEKKNSPSGLGPVKRQVAVKSTRGFALKSTHGIAIKSTNLASGENMPVRRNTR
QFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAG
TELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3882 nt NT seq  +upstreamnt  +downstreamnt
atgacactgaagggaaaaggttgggtaaatttgagtctgacctgttgtgacagtgaaaga
ggagagggagcttctgccactatggcggagtccccagagatgatggagcttcagcgagag
gtgatggaggagctcggcatctccctggaggatctcaggcagctgattgaagaggagctg
gaaaagtcggagtccatcaagcagcggaagcaggagttggagtccctggaggagtgcgtg
aagcagaaggaggcggaggtggcccacgtggaccagctcctggacagtgctgtgaaagct
gtagataaatgtgaggtgctagtgaaggatgtatatgcaaatttgggcctggagtaccgg
gagacggactcagaagaagagataggctcttccaaacctacagaagtgattgagatacca
gatgaggatgatgacgacatcatgagtattgactcagatgcaaataacaaaattgcgaag
gaccaatcattgctcagagaagccatggctgccatgaggaagtccgctcaggatgtacag
aagttcatggacgcagtgaataaaaagtccaatagctttgacttccagagaggatcccag
cagctgagccccggctgcgagattacccaggacggggaccttgctgtcggcgaccgggtc
ctgggcaagaagcggaccaagacgtggcacaagggcaccctgatcgccatccagaacgtg
ggtcctgggaagaaatacaaggtgaagtttgataacaaaggaaaaagcctgctgtcaggc
aaccatattgcttacgattcccacccgcacgctgacaagcttcacgtggggagccgggtt
gtggccaaatacaaggacggaaaccaggtgtggctttacgctggcatcgtggctgagacg
cccaacatcaagaacaagatgaggttcctcatcttttttgacgatggctatgcctcctac
gtcatccagcctgagctctacctaatctgcagacccctcaagaagtcctgggaggatatc
gaagacatctcgtgccgggattttatcgaggagtacatcaccgcctatcccaaccggccg
atggtgttgctcaagagcggccagcagatcaagaccgagtgggacgggacctggtggaaa
tctcgcgtggaggaagtggatggtagtttggtcaaaatcctcttcctagtaggcccggct
caggatgacaagcgctgtgagtggatctaccggggctccacccgcctggagcccatgttc
agcatgaagacctccaccgcctctaccctggaaaagaaacagggagggcaaatgaggact
cgcccaaatgtcggcgccgtgcggagcaaagggccagtggtccagtacacacaggaccta
acggggaccagccctcagcagcagttcaagcccgtggagcagcccccggtgcctgtcgcg
gtgtcccagccagtttccccaccgcagttcattgaagtggatagccccgacagccagctc
tcccaggccaagaagcagcaggtggcaaagaagagcacatctttcttgcgccctggctcg
gtgggatcggggccaccctctccatcctccccagtcccgagcgaaacgccccccgtcggc
aggacaggggtgacgcaacagttccggttctcgggcgcccagcctgcgggcagccctgcc
cagccgttccacaacatgctggaccaggtgcccaacgagccctcgtaccgagcccccgtg
gagaagctgttctacctgccccacgtctgcagctacacctgcctctcccgggtgcgcccg
tactgcaccgaccagtaccgtagcaagaaccccctcctcatcccgctcctctacgacttc
cggcgcatgacggcccgccggcgcatcaaccgcaagacgggcttccacgtcatctacaag
actccctgcggcctgtgcctgcgcagcatggccgagatcgagcgctacctctttgagacg
gagtgcgacttccttttcctggagatgttctgcctggacccctacgtcctggtggaccgg
aagttccagccgtacaggccgttctactacatcctggacatcaccaacggcaaggaggac
gtccccctctcctgcgtcaacgagatcgacaacaccccgcccccgcaggtggcctacagc
aaggagcgcatccccggcaacggggtcttcatcaacacccgggctgagttcctggttggc
tgtgactgtgaggatggctgccgggacaaatctaaatgcgcctgccaccagctcaccatc
caggccactgcttgcacccccggaggccagatcaaccccaattccggataccaatacaag
aggctggaggagtgccttccgacaggagtgtacgagtgcaacaagcgctgcaggtgcaac
cggaacatgtgcaccaaccgcctggtgcagcatggcctccaggtgcggctgcagctgttc
aagacccagaacaagggttggggcatccgttgcctggacgacattgccaagggctctttc
gtctgcatctacgctgggaaaattctgacggatgactttgccgacaaagagggcctggag
atgggcgacgagtactttgccaacctggaccacattgagagcgtggagaactcgaaggaa
ggctacgagagcgaggccaagtgctcctcggacagcagcggtgtgaacctgaaagacgac
gacgacgagaacacggcctccgaggagcccgaggagtccaacgaggacagctcggatgac
aacttctgcaaggacgaggacttcagcaccagctcggtctggcgcagctacgccacccgg
cgccagacgcggggccagcgggagaacggcctctcggagacggcgtcgaaggactcaggg
ctggcccggcaggtcagccacgaggaggccgccccctgcaagcccccgctctcggaggag
acctccaagaacaaggtggcctcctggctcagctccaataccctggccgacggctttcag
gacagcgacagccggtcctcctttcgggcacaggagctgccaccgccacctgccaaggcc
gagccggcggagagcgagaggaccggggtggctgggaaagaggagttcatcccggagggt
gacctgaaggtcaagaagaaagaggtaacaggggaatctgaagaccacggcaaaatgtct
ctagtgggcaatctaggcaggttatatggctacaaccctaacccaacaatacctgaaggg
gtccggaggccggtcagcaaaacagccttgcatcagaaccgaaggcagtccgaccatccg
cagcccaccaaagacgacatcctcatgctatcgagcagcaccgacagcgagggagacaat
ggccgagggacctccgggcaggcgccaggcaatgccaacgacagcgacgacatccagacc
atttcctcgggctcagatctggaggaaaaaaagaactccccttccgggctgggccccgtg
aaacggcaggtggccgtgaagtccacccgaggctttgccttgaagtccacccacggcatc
gccatcaagtccaccaacctggcctccggggagaacatgccggtccggagaaacacgcgc
cagttctatgacggcgaggaatcgtgctacatcattgatgccaagctggaaggcaacctt
ggccgatacctcaaccatagctgcagccccaacctctttgtgcagaacgtctttgtggat
acgcatgaccttcgctttccctgggtggccttcttcgcaagcaagaggatccgcgctggc
acggagcttacgtgggactacaactacgaagtgggaagcgtggaaggcaaggagcttctc
tgctgctgcggggccattgaatgccgaggacgcttgttataa

DBGET integrated database retrieval system