KEGG   Pogona vitticeps (central bearded dragon): 110082356
Entry
110082356         CDS       T05000                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110082356 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pvt04052]
    110082356 (EPO)
Cytokines and growth factors [BR:pvt04052]
 Cytokines
  CSF and other factors
   110082356 (EPO)
SSDB
Motif
Pfam: EPO_TPO DUF1612
Other DBs
NCBI-GeneID: 110082356
NCBI-ProteinID: XP_020655478
UniProt: A0A6J0U6C3
LinkDB
Position
Unknown
AA seq 176 aa
MGRSGLILLLLTLGILHPASLVPLQPMCDQSVMDKYIQDASTIESEIEQLCRTSCCFPEP
VTVLDTRVNFPAWKAMDRSRQASEVWRGQALLSAAVLQVKRQQPAVFLHHLEAIESHLRS
IREILRGHHAQAAAQDEPSSPTLSVRTVKKLVNVYSSFLRGKVNLFVSGACRGDGR
NT seq 531 nt   +upstreamnt  +downstreamnt
atggggagatctgggctgattcttctcctgttgacactgggaattctgcacccggcttcg
ctcgttcccctgcaacccatgtgcgaccaaagtgtcatggacaagtacatccaagatgcc
agcaccattgaaagtgaaatcgaacagctttgtaggacctcctgttgcttcccagaaccc
gtcacggtgctggataccagggtgaatttccctgcctggaaagctatggacaggtcaagg
caggcgtctgaggtctggcgaggccaggcgctcctttctgccgctgtcctgcaggtgaaa
aggcaacagccggcggttttcctccaccacctggaggcgattgagagtcacctgcgcagc
atccgggagattctgcggggccaccatgctcaggcggcagctcaggatgagccctcgagc
cccacgttgagtgtacggactgtgaaaaagctggtcaatgtttactcaagtttcctgcgt
gggaaagtcaacctgtttgtttcaggagcctgccggggcgacggcaggtga

DBGET integrated database retrieval system