KEGG   Pogona vitticeps (central bearded dragon): 110082464Help
Entry
110082464         CDS       T05000                                 

Gene name
PARK7
Definition
(RefSeq) protein DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvt01002]
    110082464 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvt04147]
    110082464 (PARK7)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     110082464 (PARK7)
Peptidases [BR:pvt01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   110082464 (PARK7)
Exosome [BR:pvt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110082464 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 110082464
NCBI-ProteinID: XP_020655682
LinkDB All DBs
Position
Unknown
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPTDVMRRAGIAVTVAGLGGKDPVQCSRDVVICPDKSLEE
AQKEGPYDVVVLPGGNLGAQNLSESPRVKDVLKDQDGRKGLIAAICAGPTALLAHGIGFG
SKVTTHPLAKDKMMNGDHYKYSESRVEKDGHILTSRGPGTSFEFGLAIVEELLGKEVAAQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaagagagcgttggtgattctggccaaaggggccgaggagatggagaccgtc
atccccaccgatgtcatgaggagggcgggcattgctgtgaccgtcgcaggcctgggcgga
aaagaccccgtgcagtgtagccgggacgtcgtgatctgtccagacaagagcttggaggag
gcccagaaggagggtccctatgatgtggtggtcctgccaggaggaaacctgggtgctcag
aacctgtcagagtctcctcgggtgaaggacgtcttgaaggaccaggacggccggaagggg
ctcattgcggccatttgtgcaggtcccacagctctgctggcccacggaataggctttgga
agcaaagtgaccacccaccccttggccaaggacaaaatgatgaatggagatcactacaag
tactcggagagccgcgtggagaaggatgggcacattctgaccagccgaggccctggcacc
agcttcgagtttggccttgccatcgtggaagagctgctgggcaaggaggtggctgcccag
gttaaggcgcctctggtgctgaaggattag

DBGET integrated database retrieval system