KEGG   Pogona vitticeps (central bearded dragon): 110083191Help
Entry
110083191         CDS       T05000                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00250  Alanine, aspartate and glutamate metabolism
pvt00410  beta-Alanine metabolism
pvt00430  Taurine and hypotaurine metabolism
pvt00650  Butanoate metabolism
pvt01100  Metabolic pathways
Module
pvt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110083191 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110083191 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110083191 (GAD2)
   00430 Taurine and hypotaurine metabolism
    110083191 (GAD2)
Enzymes [BR:pvt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110083191 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 110083191
NCBI-ProteinID: XP_020657110
LinkDB All DBs
Position
Unknown
AA seq 584 aa AA seqDB search
MAAPGAGFWSFGSEEGSGDPDNPGPAKAWCQAAQKFTGGISTKLCALLYGDGDKPMETGA
TKEEPTLRKAACSCNKKPCGCQKEDINYAFLHASDLLPNSEGEAATLSFLQDVVDILLQY
LVTNFDRSTKVIDFHYPNELLQEYNWELSDQPQTMEEILLHCRTALKYAIKTGHPRYFNQ
LSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLRKMREIVGWPGGAGDGIFSP
GGAISNMYAMLIARFKMFPEVKEKGMAAIPRLVAFTSEHSHFSVKKGAAALGIGTDSVIL
IRCDERGKMIPSDLERRIIEAKQKGFVPFLVSATAGTTVYGAFDPLIAIADICKKYKIWM
HVDGAWGGGLLMSRKHRWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQM
HASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTIGFEAHIDKCLELAEYL
YNKIKNREGFEMVFDGKPQHTNVCFWYVPPSLRIMEDNEERMNRLSKVAPVIKARMMECG
STMVSYQPLGDKVNFFRMVISNPAAAHQDIDFLIEEIERLGQDL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcccggcgcgggcttttggtccttcgggtccgaagagggttccggagacccg
gacaaccccggtccagcaaaagcttggtgtcaggctgcccagaagtttacaggaggcatt
tctaccaaactctgtgcgctgctgtacggagatggggacaaacccatggaaaccggagct
actaaggaggaaccgacgttgagaaaggcggcttgcagctgcaataaaaagccttgcggc
tgccagaaagaagacattaattatgcttttttacacgcctcagatctcctgccaaactct
gagggagaagcagctacgttgtctttcctacaagatgttgtggacattttgctccagtac
ctggtgacaaattttgatcgctcaaccaaagtgattgatttccattatccaaacgagctt
cttcaggaatataactgggaattgtctgatcaaccccagactatggaagaaattctccta
cattgcaggaccgcgttaaaatacgccattaaaacaggacatcccaggtatttcaatcaa
ctatcaactggattggatatggttggattagctgcagattggctaacttctacagccaac
actaacatgttcacctatgaaattgctccagtgtttgtacttttggagtatgtcacatta
agaaaaatgagggaaattgttggctggccagggggtgctggcgatggaatattttctcct
ggtggtgccatatctaacatgtatgctatgttgattgcacgtttcaagatgttcccagaa
gttaaggagaaaggaatggcagctattccaagactggttgccttcacatcggagcatagt
catttttctgtgaagaaaggagcagcagccttaggaattggtactgacagtgtgatttta
atcaggtgtgatgagagagggaaaatgatcccatctgatcttgaaaggagaatcattgag
gcaaagcagaagggatttgttcctttcctagtaagtgccacagcaggaaccacagtatat
ggggcatttgatccactgatagcgattgccgatatctgcaaaaagtacaagatctggatg
catgttgatggagcatggggcggtgggctgctgatgtcaaggaaacatagatggaaatta
aatggtgttgaaagggccaattctgtgacatggaatccacataagatgatgggggtccct
ctgcaatgctctgcgttgcttgttcgagaagagggactgatgcaaagctgcaatcaaatg
catgcttcctacctctttcaacaagacaagcactacgacctgtcatatgacactggagac
aaggccttgcaatgcggccgccacgttgatgtcttcaaactatggctgatgtggagggca
aagggcactataggttttgaagcacacatcgacaagtgtttggaacttgccgagtacttg
tataataaaataaagaaccgagaaggctttgaaatggtgtttgatggaaagcctcagcac
acaaatgtttgcttttggtacgtgccacccagtttacggattatggaggataatgaagaa
agaatgaatcgcctctcaaaggtggcccctgtaattaaagcccggatgatggagtgcggt
agcactatggtcagctatcagcccctgggagacaaggttaacttcttccgcatggttatc
tccaatccagcagcagctcaccaagacatcgattttctgattgaggaaatagagcgcctt
gggcaagatttatag

DBGET integrated database retrieval system