KEGG   Pogona vitticeps (central bearded dragon): 110083855Help
Entry
110083855         CDS       T05000                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00010  Glycolysis / Gluconeogenesis
pvt00053  Ascorbate and aldarate metabolism
pvt00071  Fatty acid degradation
pvt00280  Valine, leucine and isoleucine degradation
pvt00310  Lysine degradation
pvt00330  Arginine and proline metabolism
pvt00340  Histidine metabolism
pvt00380  Tryptophan metabolism
pvt00410  beta-Alanine metabolism
pvt00561  Glycerolipid metabolism
pvt00620  Pyruvate metabolism
pvt01100  Metabolic pathways
Module
pvt_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110083855 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    110083855 (ALDH2)
   00620 Pyruvate metabolism
    110083855 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110083855 (ALDH2)
   00561 Glycerolipid metabolism
    110083855 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110083855 (ALDH2)
   00310 Lysine degradation
    110083855 (ALDH2)
   00330 Arginine and proline metabolism
    110083855 (ALDH2)
   00340 Histidine metabolism
    110083855 (ALDH2)
   00380 Tryptophan metabolism
    110083855 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110083855 (ALDH2)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110083855 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110083855
NCBI-ProteinID: XP_020658331
LinkDB All DBs
Position
Unknown
AA seq 422 aa AA seqDB search
MDASHRGKLLNRLADLIERDRAYLAALETLDNGKPYSISYLVDLDMVVKHLRYYAGWADK
LHGKTIPIDGDFFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKLAEQTP
LTGLYVANLVKEAGFPPGVVNIIPGYGHSAGAAISAHMDVDKIAFTGSTEVGHLIQKAAA
ESNLKRVTLELGGKSPNIIMSDADMDWAVEQSHSALFFNQGQCCCAGSRTFVQEDIYHEF
VEKSVERAKSRVVGNPFDFKTEQGPQVDESQYKKILGYISTGKKEGAKLMCGGNPAADRG
YFIQPTIFGDVQDDMTIAREEIFGPVMQILKFKTIEEVIHRANDTKYGLAAAVFTKDIDK
ANYISQGLRAGTVWINCYNVFGCQVPFGGYKTSGQGREGGEYGLTPYMEVKTVTIKVPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgcctcccaccggggcaagctgctcaaccgcctcgctgacctgattgagagagat
cgggcgtatctggcagctctggagacactggacaacggcaagccctactcgatttcctat
ctggtggatttagacatggttgtcaagcatctccggtactatgcaggctgggctgacaag
ctccatggcaaaaccatccccatagatggagacttctttacctacacaagacatgagcct
gtgggagtctgcggacaaatcattccgtggaatttcccgttactgatgcaggcgtggaag
cttggcccagctcttgccacggggaatgtggtggtgatgaagctggcagagcaaaccccc
ttgaccggcttgtacgtggccaacctggtcaaagaggctggattcccaccgggcgtagtg
aatataattcctggctacgggcactctgccggcgctgccatctccgcccatatggacgtg
gacaaaatcgcatttactggctccacagaggttgggcacctgatccagaaggctgcagca
gagagtaatctgaagagagtgacccttgaactaggaggaaagagccccaacatcatcatg
tccgatgccgatatggactgggctgtcgagcaatcccattccgccttgttcttcaaccaa
ggccagtgctgctgtgcaggatcccggacgtttgtccaagaagatatataccacgagttt
gtagagaagagcgtggagagagccaagtcccgagtagttggcaatccctttgacttcaaa
acagaacaaggacctcaggtagacgagagtcagtataagaagatccttggatatatcagt
accggaaaaaaggaaggagccaaactgatgtgcggagggaaccccgcggcggacagaggc
tacttcattcagccaactatttttggagacgtacaagatgacatgacaattgccagagaa
gagatatttggaccagtcatgcagatcttaaagttcaaaaccatcgaggaggtcatccac
agagccaacgacacaaaatacgggctggcagcggccgtcttcacaaaagatatcgacaaa
gcgaactacatctcccagggtctgcgcgccggaactgtctggataaattgctacaacgtg
tttggctgtcaggttcccttcggaggttacaaaacctctggacaaggtcgtgagggggga
gaatacggtctgaccccatacatggaagtgaaaacagtgaccatcaaagtcccgcagaag
aattcttaa

DBGET integrated database retrieval system