KEGG   Pogona vitticeps (central bearded dragon): 110084704Help
Entry
110084704         CDS       T05000                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00052  Galactose metabolism
pvt00500  Starch and sucrose metabolism
pvt01100  Metabolic pathways
pvt04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110084704
   00500 Starch and sucrose metabolism
    110084704
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110084704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvt04147]
    110084704
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110084704
Exosome [BR:pvt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110084704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 110084704
NCBI-ProteinID: XP_020659956
LinkDB All DBs
Position
Unknown
AA seq 926 aa AA seqDB search
MKLYQKLTTYVPQITEATEDAADEKPLCHQKLSAWWLGGGLLMVAGLLSGVTVWVLGQIW
WSQHETHPLTKCISIPEDLRFDCYPERNVVVTRELCEGRGCCFVDSQQGSGGTSGVPWCF
YPPDFPSYTLGSVNETELGMVGFLTRKTKTYYPKDIEKLQLSVEFETDARLHVKITDASS
PRYEVPLDVPTAKRKAENPVYAVEFSKEPFGLIVTRKASGTVLLNTTVAPLFYADQFLQV
STLLPSAYLYGLGEHQSNFLHSLEWNTLTFWARDVPPTESCNLYGVHPFYLVMEKGGAAH
GVFLLNSNAMEVSLQPAPALTWRTIGGVLDFYIFLGPDPNLVVQQYQQVVGFPAMPPYWA
LGFHLCRWGYGTSNETWETVKAMRNFQIPQDAQWNDIDYMDSYRDFTTDPQKFGALPQLV
GDLHKHGQSYVMIVDPGISSASSPGSYWPYDEGLKRGVFINNTEGKPLIGKVWPGLTAYP
DFSNPDTHQWWLENLSRFYSLVPFDGVWIDMNEPSNFMDGSSEGCSQGELDNPPYVPAIL
GGSLSAKTICASARQNTSSHYNLHNLYGLMEAKATASALVQIKGKRPFVISRSTFPSQGK
YSGHWLGDNRSEWKDMFWSIPGILSFSLFGIPLVGADICGFSGSTSEELCLRWTQLGAFY
PFSRNHNTQGEKAQDPTAFSPVARAAMKEALEVRYALLPFLYSLFHRAHLQGDTVVRPLF
FEFPKDVATYAIDRQFLWGRGLLVTPVLDPGMDSVIGYFPRGLWYDYYTGSSVNSSGENL
KMAAPLDHINLHVREGTILPTQKPGSSTSESRKNPLGLIAALSQNSNAWGDLYWDDGESL
DTFAKGDYAYLVFNVTQGTFTSTVLHSNVEATYITVDTLTVYGVREEPKTVVVNGKEWPF
TYLTNQVLTVGDLQLNLSQGFYVRWL
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtatcagaagctgacgacatacgtcccccagattactgaagccacggaggac
gccgctgatgagaagccgttgtgccatcagaagctgtctgcctggtggctgggtggaggt
ctcctaatggtagctggtctccttagcggagtgactgtttgggtgctcgggcaaatttgg
tggagtcagcacgaaactcaccccctgacgaagtgcatctctattccggaagaccttcgc
tttgactgttacccagaaagaaatgtcgtcgtgactcgagaactgtgcgaaggccggggc
tgctgctttgtcgacagccagcagggctctggtggcaccagtggcgtgccttggtgcttt
tacccacctgacttccccagctacaccttgggcagcgtgaacgagacagagctggggatg
gtgggctttctgaccaggaaaacaaagacctattaccccaaagacattgagaagctgcag
ctcagcgtggagtttgagacggatgctcggttgcatgtcaagatcacggatgcgtccagt
cctcggtacgaggtgcccctggatgtacctacagcgaagaggaaagcagagaatcctgtc
tacgcggtggagttctccaaggagccctttgggttgatagtgacgcggaaagcttcgggg
accgttctgctgaacaccacggtggctcctctcttctatgccgaccagtttctccaggtt
tccaccctccttccctctgcctacctttatggcctgggagaacaccagagcaactttcta
cacagtctggagtggaacaccttgactttctgggctcgagatgtccctcccacggagtcc
tgcaatctctacggcgttcacccgttttatcttgtcatggagaaaggtggagctgcccac
ggggttttcctcttgaatagcaacgcaatggaggtgtcccttcagcctgctcccgccctc
acctggaggaccatcggcggagtcctggatttctacatctttctaggacccgaccccaac
ctggtggtccagcagtaccagcaggtcgttggcttcccagccatgcccccttattgggct
ctgggcttccacctctgccgctggggttatggaacgagcaacgagacctgggagacggtg
aaagccatgaggaactttcagatcccccaggatgctcagtggaacgacattgactacatg
gacagctatcgggacttcaccacagacccgcagaagttcggcgcgctccctcaactggtg
ggagaccttcacaaacacgggcagtcctacgtgatgattgtggatcctgggatcagcagc
gcttcctctccgggctcttactggccttacgacgaaggcttaaagcgtggcgtcttcatc
aacaacacggaagggaagcctttgatagggaaggtttggcctggtctcaccgcctaccct
gatttttctaacccagatacccaccagtggtggctggaaaacctgagtcgcttctactct
ctcgtcccctttgatggtgtttggatcgacatgaacgaaccatccaactttatggacggc
tcatcagaaggctgttctcaaggagaactggacaacccaccctacgttcctgccatcctg
gggggctccctttcagccaagaccatctgtgcctctgccagacaaaacacgtcatcccac
tacaacctccacaacctctacgggctgatggaagccaaagcgactgcaagcgctctggtc
caaatcaaggggaagcggccctttgtcatctctcgctccactttcccaagccagggcaag
tattcgggacattggcttggggacaacagaagcgagtggaaggacatgttctggtctatc
ccaggcatcctgagcttcagcctctttggaattcccttggtgggggcagacatctgcggc
ttctccggttccacctcggaagagctgtgccttcgctggacgcaactgggagccttctat
cccttttcgcgaaaccacaacacccagggcgagaaggctcaggatcccaccgcgttcagc
ccggtggcacgggctgccatgaaggaggccctggaagtccgctacgccctgctgcctttc
ctctattccctcttccatcgggcccacctgcaaggggacaccgtcgtccggcctctgttt
tttgagttcccaaaggacgtggccacctacgccattgacagacagtttctctggggacga
gggctgctggtgacgccggtgctggatcctggcatggattcggtgattggctacttcccc
cgaggcctgtggtacgactactatacgggctcttcggtgaacagcagcggggagaacctg
aaaatggcggcgcctctggaccacatcaacctgcacgtgcgggaggggaccatcctgccc
acccagaaacccggatccagcacttcggagagccgcaagaaccctttgggcctgatcgcg
gccttgtcgcagaactccaacgcctggggggacctttactgggatgacggggaaagcttg
gacaccttcgccaagggcgactatgcgtacttagtgttcaacgtcacacagggcaccttt
acctccaccgtccttcattccaacgtggaagccacctacatcaccgtggatactttgact
gtctacggagtccgggaggagcccaagaccgtcgtggtcaacgggaaggaatggcctttc
acctatttgaccaaccaggtcctcaccgtgggtgatcttcagctaaatctcagccaggga
ttctacgtacggtggctgtga

DBGET integrated database retrieval system