KEGG   Pogona vitticeps (central bearded dragon): 110085330Help
Entry
110085330         CDS       T05000                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00052  Galactose metabolism
pvt00500  Starch and sucrose metabolism
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110085330 (MGAM)
   00500 Starch and sucrose metabolism
    110085330 (MGAM)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     110085330 (MGAM)
    3.2.1.20  alpha-glucosidase
     110085330 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 110085330
NCBI-ProteinID: XP_020661054
LinkDB All DBs
Position
Unknown
AA seq 2704 aa AA seqDB search
MEKKKFSGLEVTLITLFLLAAVVASILIGLLATGHSGFKDFSPTCPNVQSHEKINCLPDQ
VATQAACALRGCCWSPQNESSIPWCYFSSNHGYRTAGSTKDTNTGFEVKLKRNAAPSLFG
GDISEVLLTAEYQTTNRFRFKITDPAKKRFEVPHEHVKPFEGQKATNPNYRVEVINNPFA
IQVIRNSNNKVLFDTSIGPLVYADQFLQLSIRVPSWNVYGVGEHVHKQYRHDFNWKTWPI
FTRDAFPNGDMSNLYGAHTFFLCLEDNTGHSFGVFLMNSNAMEFALQPAPAVTYRTIGGI
LDFYIFLGNTPEQVVQEYLSFIGLPWMPSYWSLGFHICRWDYKDLNDVKAVVERNRAAGI
PYDVQYTDIDYMEDAKDFTYDEINFAGLPEFAQDLHAHGQKYAIILDPAISTGNRRNNTP
YEAYINGERMKVWVNASNGIDPLIGEVWPGTAVFPDYSNPDAITWWTNESKTLHNTLDFD
GLWIDMNEVSNFVKGSRTGCEENNLNYPPYTPKIIDGVMYSKTLCMDAVQKAGKQYDVHS
LYGYFMTIATDQALQTVFPGQRSFMLSRSTFAGSGKFSGHWLGDNAATWNDIKWSLPGML
EFGLFGYPFIGADICGFFDNVSEELCRRWLQVGAFYPFSRNHNSEINEPKDPASFGQNSR
LVNSTKHYLNIRYTLLPYLYTLFYKAHTQGSTVARPVLHEFYSDEATWAIDRQFLWGPGL
LITPVLDAGVDTVTAYMPDAVWYEYETGSKAVCRKQECQMHLPADKIGLHLRGGYIFPTQ
QPANTTVYSRQNPMGLIIALDGNQSAVGDLFWDDGVTRGTVENQAYILYQFSVSNNVLTM
TVVHSGYTDPNNLQFEEIKILGLPLQPTELKVTSNNVAQTYPVNVNYSVSDKVAHITGLQ
LKLGESHTISWAQVLTNSDKFDCHPDPDATLESCQALGCLWNDLVPEGVPFCYYPDNYDR
DVYTVQQVQYTSSGLTADLGINMKSIKSPRLTVTPIGTLRLEVIYHENHMFQFKIYDYSN
KRYEVPVPLNLSSTPASTLENRLYDVSVQNYPFGIQVRRRSSGTVIWDSQLPGFTFSDMF
IQISTRLPSQYVYGFGETEHQQYQHEMDWVTWPMFARDQSPGYKFNMYGVHPFYMGLEND
GNAHGVLLLNSNGMDVKFQPTPALTYRTLGGILDFYVVLGPTPEQVVQEYTALIGRPVMP
PYWGLGFQLCRYGYENDTEISDLYDQMKAANIPYDVQYADIDYMERQLDFTLSSKFANLP
TVVNRLKADGMRFVIILDPAISGNETNYPPFTRGVQDDVFIKWPNGSSIVWGKVWPYLPG
VVVDPSAGWDEKVEKYSAWAAFPDFFRNSTAEWWKREIQEYHTNPVTPAKSIKFDGLWID
MNEPANFVNGAITGCGDSELNRPPYLPAILGNDIGLSSKTLCMQSQQHLPDGSPLRHYDV
HNLYGWSQTKPTYDALHSVTGERGIVISRSTYPSSGRWAGHWLGDNYSRWDQLYKSIIGM
MEFSLFGMSYTGADICGFNEETTYQMCARWTQLGAFYPYSRNHNGLGSKRQDPVSFDDHF
KEIARNVLNTRYTLLPYLYTLMYEAHAHGSTVVRPLLHEFTDDKTTWDIYEQFLWGPALL
ISPVLHENATIVEAYFPDAPWYNYYTDKVEKVRGQFQNISTPLEDINLHLRGGYIIPWQL
PGLNTEASRKKMMGLTVALDDNESAQGLLYWDDGTTIDAYEKGLYLLHTFKASPGVLDIS
VTHRGYTDPNNLKIGEIKILGLVGGSIFSVTVLQNGVPISSNYNTTYNSSSQALHLTNLE
LALGQEYTVRWNQETEKFDCYPYPEPTQVTCENRGCIWQVVSTPGIPHCFYPRNYGYSVS
NIQNSNVGLSADLQRNTEFPNPYGTRSPPVDQLRLEVKYHYNDMLQFKIYDPNSKRYEVP
VPLFTPDVPESSEANRLYQVEIVDNPFGIRIHRKSTGTVIWDSQVPGFTFSDMFIQIATR
LPSQYIYGFGENEHTHFRRDMNWESWGMFTKDQPPGYKLNSYGFHPFYMGLENDGSAHGV
LLLTSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPEEVVQGYTRLIGRPVMPPYWALG
FQLCRYGYKNTSEVDDLYTAMRAARIPYDVQYTDIDYMERKLDFTLGQNFRDLPAFVDRI
KSEGSRFIIILDPAISGNETEPYPTFTKGVQNNVFITWPNTTDIAWAKVWPDYPNVTVDE
NASLEVQLELYRAYVAFPDFFRNATSAWWQEEIRNYHANYVKFDGLWTDMNEPSNFIDGA
VDGCRNRELNYPPYLPALVLRDRGLSLVTICMESEQQLPDGTPVRHYDVHNLYGWSQAEP
TYYGMHNATGERGIIITRSTYPSSGRWAGHWLGDNYARWDQLDKSIIGIMEFSLFGISYC
GADICGFFNDTTYELCARWMELGAFYTFARNHNVMGTRRQDPVSFNSTFEDISRNALNIR
YRLLPYLYTLMHNAHLYGSTVARPLLHEFVNDRVTWDIYRQFLWGPALMISPVLDEGAVT
VNAYIPDARWYDYHTGKDIGVRKQFQVLDAPLEHINLHVRGGYIIPWQVPGITTNASRAN
PMGLTVALDDYGFATGELYWDDGISIDSFENSYYFLAEYQVSNNTLRVSVLHNNYLTDSI
DLRIGYLHVWGVSASVTNVIVTHDGTEEDFLFRYDPESQILEVDFTGNVYLIYQLDQVKW
VTTS
NT seq 8115 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagaaattttctggacttgaagtcacactgatcactcttttccttttggca
gcggtcgtagcaagtattttgataggccttctagcaactggtcattctggttttaaagat
ttttcacccacatgtccaaatgtacaatcacatgagaaaataaattgccttccagaccaa
gtggcaactcaggctgcatgtgcactccgcggctgttgctggagccctcagaatgagtca
tccataccttggtgctacttttctagcaaccacggatacagaactgcagggagcacaaaa
gacacaaacacaggatttgaagttaaactaaaaagaaatgctgccccatccttgtttgga
ggtgatatttcagaagttctcctcactgcggaatatcagacaacaaaccgtttccggttt
aagattacagatcctgctaaaaaaagatttgaagtcccacatgaacatgtgaaacccttt
gagggacaaaaagcaaccaatccaaactacagggttgaagtaattaataatccttttgcc
atccaggtgatccggaatagcaataacaaagtcctttttgacacctctattggaccactt
gtgtatgctgaccagttcttgcagctctccatccgagtacccagctggaatgtatacggt
gttggagaacatgtccataaacaataccgacatgattttaattggaaaacttggcccatt
tttactcgggatgcctttcctaatggagacatgagcaatttatatggtgctcacactttc
ttcttgtgcctggaagacaacaccggacattcttttggtgtattcttgatgaacagcaat
gccatggaatttgctctccagccagctccagctgttacatacagaacaattggtggaatt
ttagatttctatattttcttgggaaacacaccagagcaagttgtccaagaatatctatcg
ttcataggacttccatggatgccttcctattggagtcttgggttccatatctgccgttgg
gattacaaggatcttaatgatgtgaaagcagttgtagaaagaaatcgagcagctggaata
ccttatgatgttcagtacactgacattgactacatggaagatgccaaagattttacttat
gatgaaataaactttgcaggcctcccagaatttgctcaagatcttcatgcccatggacag
aaatatgcaataatattggatcccgccatttctactgggaatcgtcgcaataatacccct
tatgaagcctatataaatggtgaacggatgaaagtgtgggtaaatgcatcaaatggaata
gaccctcttattggagaggtctggccaggaacagcagtcttccctgattattcaaatcct
gatgctattacatggtggactaatgagagcaaaacattacacaacacccttgactttgat
ggactgtggattgatatgaatgaagtatccaattttgttaaaggatcccgaacgggctgt
gaagaaaacaatttaaattatccaccttatactccaaagattattgatggagtcatgtat
tcaaagacactttgcatggatgcagtgcagaaggcgggaaaacagtacgatgtccacagc
ctctatggatattttatgaccatcgctactgatcaagctctccaaactgttttccctggg
caaagaagcttcatgctgtctcgttctacttttgctggatctggaaagttctccggacat
tggctgggggataatgctgccacctggaatgatattaagtggtccctcccaggaatgctg
gaatttggtctctttggatacccttttattggagcagatatttgtgggttttttgataat
gtctcagaagaactctgccgacggtggctgcaagttggagcattttatccgttttctagg
aatcacaatagtgaaataaatgaacctaaagatcctgcatcttttggacagaactctcgt
ttggtgaactcaaccaaacactatctaaacatccgctacactttgttaccatacctctat
acccttttttacaaagcacatacccaaggaagcacagtagcaagacctgttctacatgag
ttctactcggatgaagccacctgggctatcgacagacagttcttatggggccctggactt
cttattactccagtcctggatgcaggtgtggatacagtgactgcatatatgcctgatgct
gtatggtatgagtatgagacaggttcaaaggcagtttgtagaaaacaagaatgtcagatg
catctcccagcagacaaaataggacttcatctcagaggaggctacatctttccaactcag
caaccagccaacacaacagtttacagccgccaaaatcccatgggattgataattgcctta
gatggcaatcagtcagcagttggagacttattttgggatgatggcgtaaccagaggtaca
gtggaaaatcaagcttacatcttatatcagttcagcgtctccaataatgtcttaacgatg
actgtggtacacagtggctacacagatcccaataatttacaatttgaggaaattaaaatc
cttggcttgccccttcagccgacagagctgaaagtgacgtcaaacaatgtggctcagaca
tatcctgtaaatgtcaattacagtgtttcagataaggttgcccatataacaggacttcag
cttaaattgggagagtcacacacaatttcttgggcccaggtcttgacaaatagtgacaaa
tttgattgccatcctgatccagatgcaacacttgaaagctgtcaagctcttggctgcttg
tggaatgacttggttcccgaaggagtaccattctgttactacccagacaattatgataga
gacgtttatactgttcaacaagttcaatacacatcttctggtttaacggcagaccttggg
ataaatatgaaatccattaaaagtcccaggctgacagtaacgcccattggcacactgagg
ttggaagtgatatatcatgagaaccacatgtttcagtttaagatttatgattacagtaat
aaaagatatgaagttccagtaccactgaacctctctagcactcctgcaagtactcttgaa
aatcgtctctatgatgtatcggtacaaaactacccctttggcatccaagttcgacgcagg
agctctgggacagttatttgggattcccaattgcctggcttcaccttcagtgacatgttc
atccagatttccactcgcttaccctcacagtatgtgtatgggtttggtgaaacggagcat
caacagtaccagcatgaaatggactgggtcacttggccaatgtttgccagggatcaatct
cctggatacaaattcaatatgtatggagttcaccccttttacatgggcctggaaaatgat
ggcaatgctcatggagttctcttactaaacagtaatggaatggatgtgaaatttcagcca
actccagctttgacttaccgtactcttggaggaattttggacttttatgtggttttgggc
ccaactcctgagcaagtggttcaggagtacactgcactcattggacgtccagtcatgcct
ccatattggggtttgggattccagttatgccgctatggatatgaaaatgatacagaaatt
tccgatctgtatgaccaaatgaaggcagctaatatcccttatgatgtacaatatgctgat
attgactacatggaacggcagttagatttcacactcagttccaaatttgctaaccttcca
actgtggttaacagactaaaagcagatggcatgagatttgtcatcatcctggatccagcc
atttcaggaaatgaaactaactatccgccattcacacgaggtgttcaggatgatgtcttc
atcaaatggcccaatggcagttctattgtgtggggaaaggtgtggccatatctacctggt
gtcgtggtggatccttcagcaggctgggatgaaaaagtagagaaatacagcgcttgggct
gccttccctgatttcttccgtaattctacagctgagtggtggaagagagaaattcaggag
tatcacacaaaccctgttactccagcaaaaagcattaaatttgatggactttggattgat
atgaacgaaccagcaaattttgtcaatggtgcaattactggctgtggagactcagaactt
aatcgccctccatacttgccagccattttgggaaatgatattggactgagtagcaaaacc
ttgtgcatgcaaagtcaacagcatttgcctgatggtagcccacttcggcactatgatgtc
cacaacctctatggttggtcacaaactaagcccacctatgacgcactacacagtgtcacc
ggagaacgtggtatcgtcatttctcgttccacttacccttcaagtggcagatgggcaggg
cactggttgggtgacaactactcaagatgggatcagctttacaaatctataattggcatg
atggaatttagcctcttcggaatgtcctatactggtgcagatatctgtggcttcaatgaa
gaaacaacctaccaaatgtgtgctcgctggacacagctgggtgccttttacccgtattct
aggaatcacaatggcttaggatctaagaggcaagatccagtatcctttgatgatcatttt
aaagaaatagcaaggaatgtgctcaataccagatatactttactcccatatctctacaca
ttgatgtatgaagctcatgctcatggtagcacggttgtgcgccctttactccatgagttt
actgatgataagacgacatgggatatatatgaacagtttctgtggggacctgcattgctc
ataagcccagttctgcatgaaaatgctacaatagtggaagcttattttcctgatgctccc
tggtataattattacacggataaagttgagaaagtgcggggacagttccaaaacatatct
actccccttgaagacataaatctgcatctcagaggtggctacatcattccatggcaactg
cctggtttaaacactgaggccagccgaaagaagatgatgggtcttacagttgctttagat
gataacgagtctgctcaggggctcctttattgggatgatggtacaacaattgatgcatat
gagaaaggtctttacctcctgcacacatttaaagccagtccgggtgtcttggacatcagt
gtcacccaccgtggatatactgacccaaacaacttaaaaattggtgaaattaaaatccta
ggactagtaggcggctccattttctccgttacagtacttcaaaatggtgtgccaatttcg
tccaactataacacaacctataattcttcgtctcaggctttacaccttacaaaccttgag
cttgcattggggcaagaatatacagtgcgatggaatcaagagacagaaaagtttgactgt
tatccatatcctgaaccgacccaagtcacttgtgaaaatcgtggttgcatctggcaggtt
gtttctactcctggaattccacactgtttttatcctcgtaactatggttattctgtcagt
aacattcaaaacagtaatgtgggcttgtcagctgaccttcagaggaatactgagtttccg
aacccctatggaactaggtcaccaccagtggaccagcttcgcttggaagtgaagtaccat
tacaatgacatgttgcaatttaagatatatgatcccaactccaaaagatatgaagttcca
gttccactcttcaccccagatgttcctgaaagttcagaggctaatcggctctatcaggtg
gaaattgtggacaatccatttggcataaggatccaccgaaaaagcacaggaacggttata
tgggattctcaggtcccaggcttcaccttcagtgacatgttcattcagattgctactcgc
ctgccatcacaatacatatatggatttggagaaaatgaacacactcatttccggagagat
atgaactgggagagctggggaatgttcactaaagatcagcctcctggttacaaactgaat
tcctatggcttccatcccttctacatgggactggaaaatgatggaagtgctcatggagtc
cttttgctgaccagcaacgctatggacgtcaccttccaaccaacacctgctctgacatat
cgcacaattggaggaattctggacttctacatggttttggggcctactccagaagaagtg
gttcaaggatacactagactaattggacgaccagttatgcccccttattgggctttggga
ttccagctttgccgctatggatacaaaaatacttctgaagttgacgatctgtatacagcg
atgagggcagctcggataccatatgatgtacagtatacagacattgattacatggaacgg
aagctggacttcactcttggccaaaacttccgtgatcttcctgcttttgttgatcgaata
aaatcagagggttcaagattcatcatcatcttggacccagctatatcaggcaatgaaact
gagccatatcctacattcacaaaaggtgtgcagaacaatgtcttcatcacatggcccaac
accacagacattgcatgggcaaaggtatggccggattatcccaacgtaacagttgatgaa
aatgcaagtttagaagtacagcttgagctctaccgggcatatgttgcctttcctgatttc
ttccgcaatgcaacatcagcgtggtggcaagaggaaataaggaattatcatgccaattat
gtgaaatttgatggcctatggactgacatgaatgaaccatccaactttattgatggagct
gttgatggctgcagaaaccgagaattaaattatcctccatatctgccagctttggtatta
agagatagaggactaagccttgtgacaatatgcatggaaagtgaacagcaacttcctgat
gggacacccgtaagacactatgatgtgcataacctgtatggatggtcacaagcagaaccc
acttactatggtatgcacaatgccacaggagaacgtgggatcattattacccgttccaca
tacccatccagtggacgatgggcaggacattggcttggtgataactatgcaagatgggac
cagcttgacaaatccattattggtattatggagttcagcctctttggaatctcgtattgt
ggtgctgacatctgtggcttcttcaatgacacaacctatgaactgtgcgcccgatggatg
gagcttggggcattctacaccttcgctagaaatcataatgtgatgggcactaggaggcaa
gatcctgtctcctttaactcaacctttgaagacatatcaaggaatgcgctcaacatacga
tacagattgttgccctatctgtacacgctgatgcataacgctcacttatatggcagtaca
gttgcacgtcctttgttacatgagtttgtcaatgatagggtgacatgggatatctacaga
caatttttatggggcccagcactgatgatcagtccggttcttgatgaaggtgctgtgaca
gtgaatgcttacataccggatgcacggtggtacgactatcatacgggaaaagacattgga
gtgcgaaaacagttccaagtgttggatgcgccactggaacatataaaccttcatgttcgg
ggtggctacatcatcccctggcaagtgcctggtattacaaccaatgccagccgtgcaaat
cccatgggcctcactgttgctttggatgattacgggtttgccacaggagaactttattgg
gatgatggaatcagtattgattcatttgaaaacagttactacttccttgcagaatatcaa
gtgtctaataatacattgagggtctctgtgctgcacaacaactatttaactgattcaatt
gatttaagaattggttatttgcatgtctggggagtgtcagcttcagttacaaacgttatt
gtgacacatgatggaacagaagaagatttcttgtttcggtatgatccagaaagccagatt
ctagaagttgatttcactggcaatgtttacctcatttatcagctagaccaagtaaaatgg
gtgacaacctcttaa

DBGET integrated database retrieval system