KEGG   Pogona vitticeps (central bearded dragon): 110086191Help
Entry
110086191         CDS       T05000                                 

Gene name
FADS2
Definition
(RefSeq) fatty acid desaturase 2
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00592  alpha-Linolenic acid metabolism
pvt01040  Biosynthesis of unsaturated fatty acids
pvt01100  Metabolic pathways
pvt01212  Fatty acid metabolism
pvt03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    110086191 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    110086191 (FADS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110086191 (FADS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pvt01004]
    110086191 (FADS2)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     110086191 (FADS2)
Lipid biosynthesis proteins [BR:pvt01004]
 Desaturase
  Front-end
   110086191 (FADS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 CHDNT
Motif
Other DBs
NCBI-GeneID: 110086191
NCBI-ProteinID: XP_020662642
LinkDB All DBs
Position
Unknown
AA seq 448 aa AA seqDB search
MGKGGEQGEDCGGGGGDREAPIPSYTWEEVQKHNLRTDKWLVIERKVYNITQWVKRHPGG
MRVIGHYAGEDATDAFRAFHPDITFVRKFLKPLLIGELAPGEPSQDRGKNAQLVDDFRAL
RKTAEDMNLFKASPVFFSLYLGHILVMEALAWLLVSYCGTSWSITFILSIILATSQAQAG
WLQHDFGHLSVFKKSSWNHVAHKFVIGHLKGASANWWNHRHFQHHAKPNIFKKDPDVNMM
HLFVLGDTQPVEYGKKKLKYFPYNRQHEYFFLVFPPLLIPVYFHLQIFTTMFRHKFWVDL
AWAFSYYIRYLITYAPFYGLFGSMCLLTFVRFVESHWFVWVTQMNHIPMEIDNEKHRDWL
SGQLAATCNVEPSFFNDWFSGHLNFQIEHHLFPTMPRHNYYKIAPLVKSLCAKYQVPYEE
KPLLKAFSDIVGSLKKSGELWLDAYLHK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggcggggagcaaggcgaggactgcggcggcggcgggggcgaccgggaggcg
ccgatcccttcctacacttgggaggaggtccagaagcataacctgcggacggacaagtgg
ctggtgatcgagcggaaggtgtacaacatcacccagtgggtcaagcggcacccgggaggg
atgcgcgtgatcggccactacgccggcgaggatgcgacggatgcctttcgggcttttcat
cctgacatcacctttgtacggaaatttttaaagccattgctgattggagaacttgccccg
ggagaacctagccaagacagaggcaagaatgcccaattggtggatgatttccgggccctg
aggaagacagcagaagacatgaacttattcaaagccagtcctgtatttttttccctttac
ttgggtcatatacttgtgatggaggcactggcttggttactagtatcatattgcggtaca
agttggagcataaccttcatcctttccatcatccttgcaacctctcaggctcaggccgga
tggctgcaacacgactttggacatctctctgtatttaagaagtcgtcatggaaccatgta
gcccataagtttgtgattggtcacttgaagggtgcctcagcaaattggtggaatcatcgg
cacttccagcatcacgctaagcccaatattttcaagaaagacccagatgtgaatatgatg
cacctctttgttctgggggatacacagcctgttgagtatggaaagaagaagctgaaatat
ttcccatacaaccgtcaacatgaatacttcttcttagttttcccacctctcctcattcca
gtttacttccatttgcaaatcttcacgaccatgttcagacacaagttctgggtggacttg
gcctgggctttcagttactacatacgctaccttataacatacgctccattttacggactt
tttggatcgatgtgcctcctcacctttgtcaggtttgtggaaagtcactggtttgtttgg
gtcacacagatgaatcatattccaatggaaattgacaatgagaagcatagagactggctc
agtggtcagttggcagctacctgcaatgtcgaaccgtcttttttcaatgactggttcagt
ggtcacttgaattttcaaatagagcaccacttgtttcccacaatgccacgccacaactac
tacaagatagctccattggtgaagtcgctgtgtgcgaagtaccaagtcccttacgaggaa
aagcctcttctgaaagccttctcagatattgtggggtccctaaagaaatctggagagctg
tggttggatgcctacctccataaatga

DBGET integrated database retrieval system