KEGG   Pogona vitticeps (central bearded dragon): 110086304
Entry
110086304         CDS       T05000                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110086304 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110086304 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pvt04052]
    110086304 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pvt00536]
    110086304 (FGF1)
Cytokines and growth factors [BR:pvt04052]
 Growth factors
  Growth factors (RTK binding)
   110086304 (FGF1)
Glycosaminoglycan binding proteins [BR:pvt00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110086304 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110086304
NCBI-ProteinID: XP_020662794
UniProt: A0A6J0UX50
LinkDB
Position
Unknown
AA seq 155 aa
MAEGKITTFTALTEKFDLPMGNYKKPKLLYCSNGGHFLRILPDGKVDGTMDRNDRHIQLL
LTAENVGEVYIKSTESGHYLAMDASGRLYGSQLPTEECLFLERMEENHYNTYTSKMHADK
NWFVGLKKNGKTKLGPRTHYGQKAILFLPLPVSPE
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggaaaaataacaacattcacagctctgacagaaaagtttgacctcccgatg
gggaattacaagaaacccaaactcctttactgcagcaatggaggccacttcttaaggata
cttcctgatggcaaagtggatggcacaatggaccggaatgacagacacattcagttgctg
ctgacggcagagaatgtgggtgaggtgtacataaagagcaccgagtccggacactacttg
gctatggatgccagtggacgtttatatggctcacagttgccaacggaggagtgtttgttc
ctggaaagaatggaagaaaaccattataacacttacacatcaaagatgcatgcagacaag
aactggtttgtcggcctgaagaagaatgggaaaaccaaactggggccacggactcattat
ggccaaaaggcaatacttttccttcccctgcctgtgtcccctgagtag

DBGET integrated database retrieval system