KEGG   Pogona vitticeps (central bearded dragon): 110086446Help
Entry
110086446         CDS       T05000                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt03030  DNA replication
pvt03410  Base excision repair
pvt03420  Nucleotide excision repair
pvt03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110086446 (LIG1)
   03410 Base excision repair
    110086446 (LIG1)
   03420 Nucleotide excision repair
    110086446 (LIG1)
   03430 Mismatch repair
    110086446 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pvt03032]
    110086446 (LIG1)
   03400 DNA repair and recombination proteins [BR:pvt03400]
    110086446 (LIG1)
Enzymes [BR:pvt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110086446 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     110086446 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110086446 (LIG1)
DNA replication proteins [BR:pvt03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110086446 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110086446 (LIG1)
DNA repair and recombination proteins [BR:pvt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110086446 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     110086446 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     110086446 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DDR PknG_TPR
Motif
Other DBs
NCBI-GeneID: 110086446
NCBI-ProteinID: XP_020663017
LinkDB All DBs
Position
Unknown
AA seq 925 aa AA seqDB search
MQSTIRSFFQPLARKKVEEQIEENSHVEKVPSPKKKPVNSEQLINSRAPCTENSTAKKAS
QILNSGDEVNPQKSERKNTKTGDSKQESVCVTEQINPAENISPSTSPAASNSPSPTSIPR
RKTDLSQTLARKQIPKRKAEEEVNSHDSSQDNGSAKRRKGDDNDGDGSKEEPDERPMDLD
VKDEKDKNSELGEHETETKTEEEKMMELHKPSSKPISSFFAPRKTSVKTEKKTMPVLGEK
TPALKSHTEVNNHESNSFAGNSLKPSVKLEPAEYNPAKNNYHPVHDACWGPGEKVPYLAV
ARTFERIEEESARLKIIETLSNLFRSVVALSPEDLLSCVYLCLNRLGPAYEGLELGIGKT
ILMKALAQATGRQLDQIKAEAAEKGDLGLVAESSRTTQGIMFAPPKLGAAAVFSKLQAIG
RMMGSSSMNKKIDIIKSLFVACRHSEARYIARSLEGKLRIGLAEQSVLSALAQAGSLTPP
GQKFPPEVLDAAKGKSAEARKAWLDERALIVKQAFCELPNYDIIVPVLLEHGVESLPQHC
KITPGIPLKPMLAHPTKGIGEVLKRFEEAAFTCEYKYDGERAQIHILENGEVHIYSRNQE
NNTSKYPDIVSRIPKVKKTTVNSCILDAEAVAWDPDSKQIQPFQVLTTRKRKDVDAADIK
VQVCVYAFDMLYLNGQSLVQKPLSQRRTLLRDSFMEVEGQFLFATSMDTSNTDEIAEFLE
RSIKDSCEGLMVKTLEVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRA
GTYGGFLLACYDVESEEFQSICKIGTGFTDEALEKLHTSLKDHVIPQPRPYYRWGGIAEP
DHWLEAQHVWEVKCADLSVSPAHKAATGLVDEDKGISLRFPRFLRIRDDKKPEEATSSTQ
VAELYFKQQQIQNQQSIEKGDDDFY
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaccataagatcattttttcaacctctggcacgcaaaaaggttgaagaacag
atagaagagaatagtcacgtggagaaggtgcccagtccaaaaaagaaaccagtaaattct
gaacaactgataaatagtagagcaccttgtacagagaattctacagccaaaaaagcttcc
cagatacttaatagtggagatgaagtgaatcctcagaaatcagaaaggaagaatacaaag
actggggatagcaagcaggaatctgtctgtgtcactgagcaaataaaccctgcagagaat
atctccccaagcaccagcccagctgcctctaattcaccctcacctaccagtatcccacgg
cgaaaaactgacttatctcaaactttagcccgcaagcagatccccaaacggaaagcagaa
gaagaagtcaacagccatgatagctcccaggataatggtagtgccaagaggcggaaggga
gatgataatgatggagatggatcaaaagaggagccagatgagaggcccatggacttagat
gtgaaagatgagaaagataaaaattcagaactgggagagcatgagacagaaaccaaaaca
gaggaagagaagatgatggaactccataagccatccagcaaacccatatctagttttttt
gcccccagaaagacctctgtgaagacagagaaaaagacaatgcctgtcttgggggaaaag
acacctgcactgaagagccatactgaagtcaacaaccatgagtccaatagctttgctggc
aattctctcaagccatctgttaaacttgagccggcagagtacaaccctgcaaagaacaat
tatcatccagtccatgatgcatgctggggtcctggtgaaaaggtcccataccttgctgtg
gctcgtacctttgaaaggattgaagaggaatctgcccggttgaaaattatagagacccta
agcaatctgttccgctctgtggttgccctgtctccagaagacctgctttcctgcgtctac
ctctgtcttaatcgattaggcccagcatacgagggcctagagctgggtattggcaaaacc
atccttatgaaagctttggctcaagccacaggtcgacagctggaccaaatcaaggcagag
gcagcagaaaagggagatcttggactagtcgctgagagtagccgtaccacacagggcatc
atgtttgccccacccaagcttggggctgctgccgtctttagcaaactgcaggccattggg
cgtatgatgggaagttcttccatgaataagaagattgatattatcaagtctctgtttgtt
gcctgtcgccattcagaggctcgctacattgcacggtcactggaaggaaagttgcgaatt
ggtttagcagagcagtcggttctgtcagccctggcccaggcaggatcactcactcctcca
gggcaaaaatttcctccagaggtactagatgccgcaaagggcaaatctgcagaggcacgc
aaagcctggttagatgagagagccttgattgttaagcaagccttctgcgagctgccaaat
tatgacatcattgtgcctgtgcttctagagcatggcgtggagagcttgcctcaacattgc
aagatcacaccagggatccccttgaagcccatgcttgctcatccaacaaagggcattggg
gaagtattaaagcgttttgaagaagcagctttcacttgtgaatacaagtatgatggggag
cgagcccagattcatatcttggagaatggagaagtgcacatctatagccggaaccaagag
aacaacacatccaagtatcctgacattgtcagccgtatccccaaggtgaaaaagacaact
gtgaactcctgcatcttagatgcagaggctgtggcttgggatcctgattccaaacagatc
cagccattccaggtactaaccactcgcaagcgcaaggatgtagacgccgcagatatcaaa
gtgcaagtatgtgtgtatgcatttgacatgctctatctcaatgggcagtcgctggtccag
aaacccttgtcacagcgtcggactttactgcgtgactccttcatggaggttgaaggtcag
tttctctttgctacctccatggacactagtaacacggatgagatagcagaattcctcgaa
cgctccatcaaagattcctgtgaagggctaatggtgaaaacactagaagtggatgctaca
tatgaaatcgcaaagaggtcccacaattggttgaagctaaaaaaagattatctggaggga
gttggagataccctggacctggtggtaatcggcgcctacctgggcaagggcaagcgtgca
gggacatacggtggtttcctcctagcctgctatgatgtggaaagtgaagagttccagagc
atctgcaagattggcactggattcacagatgaagctcttgagaagctccatacctctctc
aaggaccatgttattccacagccacggccatactatcggtggggtggtatagcagagcct
gaccactggctggaggcccagcatgtctgggaagtgaagtgtgcggatctgtcagtttct
cctgcccacaaagcggcaacaggattggtggatgaagacaaaggtatctcacttcgtttc
cccagattcctgcgcatcagagatgataagaaaccagaggaggccacttctagcacccag
gtggccgagctgtacttcaagcagcaacagatccagaatcagcagtcaattgaaaaagga
gatgatgatttctactaa

DBGET integrated database retrieval system