KEGG   Pogona vitticeps (central bearded dragon): 110086784Help
Entry
110086784         CDS       T05000                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00010  Glycolysis / Gluconeogenesis
pvt00051  Fructose and mannose metabolism
pvt00052  Galactose metabolism
pvt00500  Starch and sucrose metabolism
pvt00520  Amino sugar and nucleotide sugar metabolism
pvt00524  Neomycin, kanamycin and gentamicin biosynthesis
pvt01100  Metabolic pathways
pvt01200  Carbon metabolism
pvt04910  Insulin signaling pathway
Module
pvt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pvt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110086784
   00051 Fructose and mannose metabolism
    110086784
   00052 Galactose metabolism
    110086784
   00500 Starch and sucrose metabolism
    110086784
   00520 Amino sugar and nucleotide sugar metabolism
    110086784
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110086784
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110086784
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pvt04131]
    110086784
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110086784
Membrane trafficking [BR:pvt04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110086784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 110086784
NCBI-ProteinID: XP_020663615
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMGRFRSEMKNGLSRDFNPTAS
VKMLPTFVRSIPDGSEKGDFIALDLGGSFFRILRVKVSHEKKQTVQMETEIYETPEDIMH
GSGTRLFDHVAECLGDFMEKQEIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGLLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLIFEGRITPELLTKGKLETKHVSAIEKSKEGLQKAKEILTRLG
VEPSHEDCIAVHHVCTIVSFRSANLVAATLGAILNQLRENKGVGRLRTTVGVDGSLYKMH
PQYSRRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRLINETLAEFKLT
HEQLLQVKKRMRIEIEAGLRKKSHDHAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRMVEMHNKIYAIPIEVMQGTGEELFDHIVSCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVEGEQGRMCVNMEWGAFGDNGCLDD
IRTIYDKTVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRS
IFETKFLSQIESDRLALLQVRAILQQLGLNGTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCDVTFLLSEDGSGKG
AALITAVGCRLRDAETHN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgcccagcttctggcctattacttcacggaattaaaagacgatcaggttaaa
aagattgataaatacttgtatgccatgcggctctcggatgaaactctgctggatattatg
ggtcgctttcggtcggaaatgaaaaatgggctgtctagggattttaacccaactgcttct
gtgaagatgcttccaacatttgtaaggtctattcctgatggctcagagaagggagatttc
attgccctggatcttgggggatctttctttcgcattttacgagtgaaagtctcccacgag
aaaaagcagacagtgcaaatggaaaccgaaatttacgaaacaccagaagatattatgcat
ggcagtggaacccggctttttgatcatgttgctgaatgtttaggagattttatggagaaa
caagaaatcaaggacaagaagttacctgttggcttcacattttcttttccatgtcggcaa
tccaagcttgatgagggaattctgataacctggacgaaacgtttcaaagctagtggcgtt
gaaggagctgatgtagtaaagttactaaacaaagcaataaagaagcgtggggattatgat
gcggacattatggcagttgtcaatgacactgtagggacaatgatgacctgtggatttgac
gaccagcgttgtgaagttggcttgattattggtactggcaccaacgcttgttacatggag
gaaatgcgacacattgatcttgtggaaggcgacgaaggccggatgtgcatcaatactgaa
tggggagcttttggggatgatggcttattagaagacatccggactgaatttgacagagag
attgatcggggttcacttaatcctgggaagcaactctttgagaagatggtcagtggcatg
tatatgggtgaacttgtcagacttatccttgtgaaaatggccaaagaaggtctgattttt
gaggggcgaattactcccgaacttctaaccaaaggaaaattagaaactaaacatgtttcc
gccatagagaagagtaaagaaggcttgcaaaaagccaaagagatcctgacccgacttggg
gttgagccttcccatgaagactgcatcgctgttcatcatgtgtgcacgattgtttccttc
cggtctgcaaacctggtggctgcaactctgggagcgatcctgaaccagctgcgggagaat
aaaggggttggccgtctgcgcacgactgtcggggttgacggttccctttacaagatgcat
cctcagtactccaggcgcttgcacaaaacggtgcgccgcttagtgcctgactcagatgtg
cggttcttgctctctgagagtggcagtggcaaaggtgctgccatggtgacagcggtcgca
tacaggctggctgagcagcatcggctgatcaacgagaccctggctgagttcaagctcaca
catgagcagctgcttcaggtgaagaaacggatgcggatcgagattgaagccggcctccgg
aagaaatcacatgaccacgcgaaagtcaaaatgctgcctacatttgtccgcagcacgccg
gatgggacagaaaatggtgacttcctggctctggatcttggaggaacaaacttccgtgtt
ttgcttgtgaagatccgaagtggtaaaaggagaatggtagaaatgcacaataaaatatat
gcaattcctatcgaggtcatgcagggtaccggagaagagctgtttgaccacatcgtttcc
tgcatctcagacttcctggattatatgggaataaaaggtgcacgcctccctctgggcttt
acgttttctttcccttgcaaacagacaagcttagatgctggtatccttctgaattggacc
aagggctttaaggctacagactgtgaaggcgaagatgttgttaatttgctaagggaagga
attaaaagaagagaggaatttgatctggatgtcgtggcagtcgtgaatgatactgttggg
actatgatgacttgtgcctacgaagatcccaattgtgaaattggacttattgtgggaact
ggcagcaatgcatgttacatggaggaaatgagaaatatagagatggttgagggagaacaa
ggaagaatgtgcgtgaacatggagtggggtgcctttggggacaacggatgcctagatgac
atcaggacgatctatgacaaaactgttgatgaatactctttaaacgctggcaagcaaagg
tatgagaagatgattagcggaatgtacctgggagaaatagtccgtaacattttgattgac
ttcactaaaagagggttcctcttcagaggtcaaatttcagagacattgaaaaccaggagc
atttttgaaacaaagttcctttcacagattgaaagtgataggttagcgctgcttcaggtc
cgtgcaatcctccagcagcttggtctgaatggtacctgcgatgacagtatcattgtcaag
acagtgtgcggagcagtgtcgagaagagcggctcagctctgcggtgctggaatggctgct
gttgtggataaaataagggagaacaggggattagatcacctggatataacagtgggcgtg
gatgggacactctataaacttcacccacacttttcacggatcatgcaccaaactgtaaaa
gacctggcacccaaatgtgatgtgacattccttctttccgaagatggcagcggcaaaggg
gcagctctcattaccgcggtgggatgtagactccgtgatgccgagacgcataactga

DBGET integrated database retrieval system