KEGG   Pogona vitticeps (central bearded dragon): 110086818Help
Entry
110086818         CDS       T05000                                 

Definition
(RefSeq) actin-85C-like
  KO
K05692  actin beta/gamma 1
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04145  Phagosome
pvt04210  Apoptosis
pvt04510  Focal adhesion
pvt04520  Adherens junction
pvt04530  Tight junction
pvt04810  Regulation of actin cytoskeleton
pvt05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110086818
  09143 Cell growth and death
   04210 Apoptosis
    110086818
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110086818
   04520 Adherens junction
    110086818
   04530 Tight junction
    110086818
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110086818
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110086818
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pvt03021]
    110086818
   03019 Messenger RNA biogenesis [BR:pvt03019]
    110086818
   03036 Chromosome and associated proteins [BR:pvt03036]
    110086818
   03029 Mitochondrial biogenesis [BR:pvt03029]
    110086818
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pvt04812]
    110086818
   04147 Exosome [BR:pvt04147]
    110086818
Transcription machinery [BR:pvt03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     110086818
Messenger RNA biogenesis [BR:pvt03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     110086818
Chromosome and associated proteins [BR:pvt03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     110086818
    NuA4 complex
     110086818
  Chromatin remodeling factors
   BAF complex
    110086818
   PBAF complex
    110086818
   SWR1 complex
    110086818
Mitochondrial biogenesis [BR:pvt03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    110086818
Cytoskeleton proteins [BR:pvt04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     110086818
Exosome [BR:pvt04147]
 Exosomal proteins
  Proteins found in most exosomes
   110086818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 110086818
NCBI-ProteinID: XP_020663687
LinkDB All DBs
Position
Unknown
AA seq 377 aa AA seqDB search
MSEAKHLDIPAVIVDNGSGLCKAGIAGESAPRSVITAIVGRSKAKASMLGAGQKEYYIGE
EAQSKRGVLSLNYPIDHGIVTCWDDMERIWRHIYKCELRIKASDRPVLLTEAPLNPLQNR
ERMTEIMFENFKVPAMYVAVQATLALYASARTTGIVMDSGAGVTHTVPIYEGYCLPHAVS
RLDVAGRDITEYFMRLLLESGHSFVSTAEREIVKDIKEKLCYVALDPILEIQAKPEYLLR
EFKLPDGNVIKIGSQLFRAPEALFTPASLGVDAPGVHQMIFNSIMKCDIDLRRDLYGNIL
LAGGSTLFCGLDERVLKEMQLQVPIGISVRIIAPPERKYCVWIGASILACLTSFRQMWVT
FQDYEEFGPGVIHRKCI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggccaaacatttagacatcccagctgtgatcgttgacaatggctccggcctt
tgcaaagccggtatcgctggggaaagcgccccgaggtctgtgatcacagccattgtgggt
cgctcaaaagctaaagcttccatgcttggggccggccagaaggaatattacatcggcgaa
gaagcccagtccaaaaggggagttttgtcgttgaattatcccattgaccatggcatcgtg
acgtgttgggatgacatggagaggatatggcggcatatatataagtgtgaattgaggatc
aaagccagcgacagacccgtcttgctcaccgaagccccactgaatcccttacagaatcgg
gaaaggatgacggagatcatgtttgagaacttcaaggtgccggccatgtatgttgcggtc
caggcgacgctggctctctacgcatcagcacgaaccacagggattgtcatggacagtgga
gccggcgtgacccacactgtccctatctatgaaggctactgcctgccgcatgcggtatcc
aggttagatgttgctggaagggatatcaccgaatacttcatgcggctgctcctggagagt
ggtcattccttcgtcagcacagctgaaagagaaatcgtgaaggacatcaaggagaagcta
tgttatgtggctctagatcccatcctggaaatacaagcgaagccagaatacctgttgaga
gagttcaaactgccagatggcaacgtgatcaagatcgggagccagcttttccgagccccc
gaggcccttttcactccggccagcttgggcgtcgatgctcccggggtccaccagatgatc
ttcaacagcatcatgaaatgtgacatcgatctccgccgagatctttacgggaacattctc
ctcgcgggcgggtccaccttgttttgcggcttggacgagcgtgtcttgaaagagatgcag
ctccaggtgccgatcgggatatcggtccggatcatcgcacccccggagaggaagtactgc
gtgtggatcggggcctcgatcctggcctgcttgacctcttttaggcaaatgtgggtcacc
ttccaagattacgaagagtttggcccgggtgtgattcatcggaaatgtatttaa

DBGET integrated database retrieval system