KEGG   Pogona vitticeps (central bearded dragon): 110088446
Entry
110088446         CDS       T05000                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00220  Arginine biosynthesis
pvt00330  Arginine and proline metabolism
pvt01100  Metabolic pathways
pvt04020  Calcium signaling pathway
pvt04146  Peroxisome
pvt04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110088446 (NOS2)
   00330 Arginine and proline metabolism
    110088446 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110088446 (NOS2)
   04020 Calcium signaling pathway
    110088446 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110088446 (NOS2)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     110088446 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 110088446
NCBI-ProteinID: XP_020666400
UniProt: A0A6J0V4E5
LinkDB
Position
Unknown
AA seq 1158 aa
MQKMMCPWQLLFKPPTGKNKSQEGKDLNNNMEKATRRVCSPEKQEESISNGLSQKPEVII
HAAAAKEKCLPGNTKQTSGCPRHLKIKNWENGTSLQDSLHHQAKEFLNCRAKVCHGSVMN
APALVRGPREEPIPRSEVLLQATEFINLFYSSSKGPKLDHQARLEAVAQEIETTGTYQLT
REELVFATKQAWRNAPRCIGRIQWSNLQVFDARSCATPKEMFEHICRHVEYATNGGNIRS
TITVFPQRTDGRHDFRIWNSQLIRYAGYQMPDGSIIGDPTNVEFTQLCIQLGWKPKYGRF
DVVPLILQVDGQDPELFELPPELVLEVPIEHPTYEWFEELDLKWYALPAVSNMLLEVGGL
EFPACPFNGWYMGTEIGVRDFCDTQRYNVLQDVGRRMGLETNRVSSLWKDKAVIEVNVAV
LHSFQKRNITIMDHHSATESFMKYMQNEYRIRGGCPADWVWLVPPISGSLTPVFHQEMLN
YILSPFYYYQVEAWKTHVWKDEKRKPRKREVKFRTWAKAALFASILSRRAMALRVPVTVL
YATETGKSETLAHQLGDLFNCAFKTKVVCMEDYNLADLEKETLVLVVTSTFGNGDSPSNG
KTLQNALLSMKKLSNPFRFAVFGLGSSMYPEFCAFARAVYQKLTQLGASPLTSMGEGDEL
NGQEEAFRAWAVTAFKAACQIFEIRGKHRIQLPKTYTCKETWEPKDFRIVYDAQPLDLRR
ALSDIHGKHVVPMNLIFRANLQTAKSRRATILIKLSCERKDEAKYLPGDHIGIFPSNQKA
LVEAILARVADAPSSDEIIRLETRSERGYWTTDQKFPACTFAQALSHFLDITTPPSQQFL
RMLSQLAKEGSEKQRLELLSHSLEEYNRWKFSNSPTIPEVLEEFPSVQVSTAFLLSQLPL
LKPRYYSISSSPDLEPRELHLTVAVVTYRTRDGTGPVHHGVCSTWLNTVDLNETIPCFVR
SAEGFRLPKDPQKPCLLIGPGTGIAPFRSFWQQRLYDREMKGIKGKGMMLLFGCRHASLD
HLYQEEMQEMHRKGVLQEVYAAYSREPGCPKVYVQDLLRNKLEAKACRLLHEEEGHLYVC
GDVRMAREVGRTVKEMFARQLGLTEEQAEDYCFQLKRQKRYHEDIFGAVFAHENQRDFSE
RKQERDLSQSGSQAQLTI
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgcagaaaatgatgtgcccttggcagttgctgttcaagcctccgaccggtaagaacaag
tcccaagaaggcaaggacctcaacaacaacatggaaaaagcgaccaggcgcgtctgcagc
cctgaaaaacaagaggaaagcatatcgaatggcctaagtcagaaaccagaggtgataatc
cacgctgcagcagcgaaagaaaaatgtctcccaggtaacaccaagcaaacctctgggtgc
ccaaggcatttgaaaattaaaaactgggaaaatggaactagccttcaagattccttgcac
caccaggccaaagagtttctgaactgcagggccaaagtttgtcatgggtctgtcatgaat
gccccggccttggtcagaggtccccgagaggaacccattccgagaagtgaagtattactc
caagcaactgagtttatcaatctgttctacagttcgtcgaaagggcccaaattagatcac
caggcacgtctggaagcggtggctcaagagatcgaaacaaccggaacctaccagctgacc
cgggaggagctggtctttgccacgaagcaggcgtggagaaacgccccgcgatgcatcggc
aggatccagtggtcgaacttacaggtctttgatgcccggagctgtgccactcctaaggaa
atgtttgaacacatctgtcgtcatgtggaatacgccaccaatggagggaacataaggtcg
accatcaccgtgttcccccagaggaccgacgggagacatgacttccggatttggaacagc
cagctcatccgatatgcaggctaccagatgccagacggctccatcataggcgatccaacc
aacgtggagttcacgcagctttgcatccagcttggttggaagcccaaatacgggcgcttt
gatgtggttccactcatcctccaagtcgacggccaggatccggagctatttgaactgcct
ccagaactcgtcctcgaagtaccgattgagcatcccacctacgagtggtttgaggaactg
gacttgaagtggtacgcactcccagccgtctctaacatgctccttgaagtcggagggttg
gaattcccagcttgtccttttaacggctggtacatggggaccgagatcggggtgcgggac
ttctgcgatacacagcgctacaatgtccttcaggatgtggggagacggatgggcctggaa
acaaaccgagtctcctccctgtggaaagataaagcggtaattgaggtgaacgttgccgtc
ttgcacagctttcagaaacgaaacatcaccatcatggaccaccattcggccaccgagtcg
ttcatgaaatacatgcagaatgaataccggattcgcggagggtgtccggcggactgggtc
tggctggtgccccccatctccggcagcctcacgcccgtcttccaccaggagatgctgaat
tacatcctgtcgcctttctattattaccaggtggaggcctggaaaacgcatgtctggaag
gacgagaaacggaagcccagaaaaagggaggtcaaattccgcacttgggccaaggctgca
ctgtttgcgtccatcctcagccggcgcgccatggctctccgagtgcccgttacggtctta
tacgctaccgaaacagggaagtcggaaacactggcccaccagctgggtgatctgttcaac
tgtgccttcaaaaccaaggtcgtctgtatggaggattacaatctagcggacttggagaaa
gagactctcgtcctagtcgtcaccagcacttttggaaatggggactccccgagcaacgga
aagacgttacagaatgctctcctatcgatgaagaagctgagcaacccattcaggtttgca
gtctttggcttgggttccagcatgtatccggagttctgtgccttcgctcgggctgtttac
caaaagctgacgcagctgggggcgtctccgttgacctccatgggtgaaggggatgaactc
aatgggcaggaagaagctttccgggcctgggcggtcacggccttcaaggccgcctgtcaa
atctttgagatccgcgggaagcaccggatccagttacccaaaacctatacatgcaaagaa
acctgggaaccaaaagattttcggatcgtgtacgatgctcagcccctggatttgaggaga
gctctcagcgacatccatggaaaacacgttgtgccgatgaatctcatcttccgagcgaat
ctgcaaacagcaaaatccaggcgagctaccatcctaattaagctttcctgcgagaggaag
gacgaagccaagtatctccctggggaccacattgggatcttccccagcaaccagaaagcc
ctcgtcgaggccatcctggctcgggtggcggatgctccgtcgtccgatgagatcattcgg
ctggaaacgcgtagtgagcgtggttactggaccactgaccagaagtttccagcttgcacc
tttgctcaggccttgagtcacttcctggacatcacaactcctccatcacagcagtttctc
aggatgctgtctcagctggcgaaagaaggaagtgagaagcagagacttgagctcttaagt
catagcttggaagagtacaaccggtggaagttttctaacagccccaccatcccggaggtc
ttggaggagttcccttccgtccaggtctcgacggcttttttgctctcccagctgccgctg
ctgaaaccccggtattactccatcagttcttccccagatctggaacccagggagcttcat
ctgacggtcgctgtggtgacctacaggactagagatggaacaggtccagtacaccatggc
gtctgcagcacctggctgaacaccgttgacctaaacgagacaatcccatgctttgtccgc
agtgctgaggggttccgacttcccaaagacccacaaaaaccatgcctcctgattggtcca
ggcacagggattgctccatttagaagtttctggcaacaacgcctctatgatcgggaaatg
aaagggatcaaagggaagggcatgatgctgctgtttgggtgtcgccatgccagcctggat
cacctgtaccaagaggaaatgcaggagatgcacaggaaaggggtccttcaggaggtctac
gcagcttactccagagagcccggctgtcccaaagtttacgttcaagacctccttcggaac
aagctggaggccaaagcctgcagacttttgcacgaggaggagggccacctctacgtctgc
ggagacgtccgcatggcccgggaagtgggcaggactgtaaaggaaatgtttgcacgacag
ctgggcttgacggaggaacaagcagaagactactgcttccagctgaaacgacaaaagcga
taccacgaggacatctttggggctgtatttgcacacgaaaaccaaagagacttcagcgaa
cgaaagcaagaaagggacctaagtcaatctggatcacaagcccagctaactatttag

DBGET integrated database retrieval system