KEGG   Pogona vitticeps (central bearded dragon): 110089205
Entry
110089205         CDS       T05000                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04210  Apoptosis
pvt04620  Toll-like receptor signaling pathway
pvt04621  NOD-like receptor signaling pathway
pvt04622  RIG-I-like receptor signaling pathway
pvt04623  Cytosolic DNA-sensing pathway
pvt04625  C-type lectin receptor signaling pathway
pvt04920  Adipocytokine signaling pathway
pvt05132  Salmonella infection
pvt05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110089205 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110089205 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110089205 (IKBKG)
   04621 NOD-like receptor signaling pathway
    110089205 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    110089205 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    110089205 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    110089205 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110089205 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110089205 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110089205 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvt01001]
    110089205 (IKBKG)
Protein kinases [BR:pvt01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110089205 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 APG6_N Csm2_III-A Hat1_N
Other DBs
NCBI-GeneID: 110089205
NCBI-ProteinID: XP_020667751
UniProt: A0A6J0V494
LinkDB
Position
Unknown
AA seq 597 aa
MSGAQRGWSCDMVQPGECPASDCGIMGDDSSLGKAATLHLPAELAGHEAVQHFLAENRDL
KEAIRQSNHMLRERYQEFLQFQVSHKEEKEFLMHKFQEARLVVENLNSERTGLKKQLKQA
VQELEQLKMKLSASQPFSFQPEKSEAQEEPDTVTLTQDVDVLAVVPEMPQQKRGLFEKDL
KELQEANEALQKEKLALQAEVRALKQAAKSTLLVEEPEVKTEANENGLLPVDHPLELDST
QRSGDRKSPGADKAEQLFKKLKEAEDESSALRQQLVLAKEELAYTAAREQETQQQLQTLG
KQLEQVGDDRATVKAQVTSLLAELAESQKRLDTSIKEKEGLEEKVRSAGERLQQLEREAE
ARTKQHSVQVDQLRLQVHNLETALRVERQSATEEKRKLAQLQVAYHQLFQEYDAHIKTSM
ENEKRSKGLDLQAAELSQQLQQAEEALVAKQEFIDKLKEEAEQHKAIMETVPVLRAQAEI
YKTDFLAERQAREKLHEQREALLEQLAQLQRDNEKLKADSEGASRALMEEMRNRHSEMRP
APQPAAFLMGANTFHPPMITGHRQSIADEQPHFSCPKCQYRAPDMDTLQIHVMDCIQ
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgagtggagcccagcggggctggagctgtgacatggtgcagccaggcgagtgcccagcc
agtgactgtggcataatgggggatgattcctctctgggcaaagctgctacccttcatcta
ccagctgagctggcaggacatgaggctgtgcagcacttcctggctgagaatcgagacctc
aaagaagccatacggcagagtaaccacatgctacgggaacgctatcaggagttcctgcaa
ttccaggtttcccacaaagaggagaaggagttcctcatgcacaagttccaggaagctcga
cttgtggtggaaaatttgaactcggaacgcactgggctgaaaaagcagctgaagcaggct
gtccaggaactggagcaactgaagatgaaactgtcagcttcccagccgttttccttccag
ccggagaagtctgaagcacaagaggagccagacacagtgaccttaactcaagacgtagat
gtgcttgctgtggttccagagatgccacagcaaaaaaggggactctttgagaaggatttg
aaggagcttcaggaagccaacgaggctttgcagaaagagaagctggccttgcaagcagag
gtcagagcactgaaacaagcagccaagtctacattgcttgtagaagaacctgaagtaaag
acggaagcaaatgagaatggacttcttccagtagaccatcccttggagttggattccaca
cagaggtcaggagacagaaagagtcctggtgcggacaaggctgagcagctattcaagaag
ttgaaggaggcagaagatgagagttcagcccttcgtcagcagctggtgttagccaaagag
gagctggcctacacggcagcacgggagcaggagacccaacagcagctgcaaacacttggc
aagcagttggagcaagttggagatgacagggccacagtaaaggctcaggtgacttccctt
ctggcggagctggcggagagtcaaaagcgcctggatacgtccataaaggaaaaggaaggg
ctggaggagaaggtccgtagcgccggcgaacgactccagcagcttgaaagggaggctgaa
gcccgcaccaagcaacacagcgtacaagttgatcagttgcggttgcaggttcataaccta
gaaacggccctgcgtgtggagcggcagagcgccacagaggaaaagagaaaactagcacag
ctgcaagtggcttatcaccagctcttccaggaatatgatgcccatatcaaaaccagcatg
gaaaatgagaagcggagcaagggcctggacctgcaggctgctgaactgtctcagcaatta
cagcaggctgaggaggctttggtggccaagcaggagtttattgacaagctgaaagaggag
gctgaacagcacaaagctatcatggagactgtgcccgttctcagggcacaggctgaaatc
tacaagacagacttcttggcagagcgtcaggctcgtgaaaagctccatgaacagcgagag
gccctgctagagcaacttgcacaactgcaaagagataatgagaagctgaaggcagactct
gagggtgccagtcgggctctgatggaagaaatgaggaatcgccattcagaaatgcgtcct
gctcctcagccagcagctttcctgatgggtgccaatacattccatcccccgatgattaca
gggcacaggcaaagcattgctgatgaacagcctcacttcagttgccccaagtgccagtac
agagctccagacatggacacgctacagatccatgtgatggactgcatccagtga

DBGET integrated database retrieval system