KEGG   Pogona vitticeps (central bearded dragon): 110089954
Entry
110089954         CDS       T05000                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00230  Purine metabolism
pvt01100  Metabolic pathways
pvt04020  Calcium signaling pathway
pvt04114  Oocyte meiosis
pvt04261  Adrenergic signaling in cardiomyocytes
pvt04270  Vascular smooth muscle contraction
pvt04371  Apelin signaling pathway
pvt04540  Gap junction
pvt04912  GnRH signaling pathway
pvt04914  Progesterone-mediated oocyte maturation
pvt04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110089954 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110089954 (ADCY3)
   04020 Calcium signaling pathway
    110089954 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110089954 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110089954 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110089954 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    110089954 (ADCY3)
   04916 Melanogenesis
    110089954 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110089954 (ADCY3)
   04270 Vascular smooth muscle contraction
    110089954 (ADCY3)
Enzymes [BR:pvt01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110089954 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Pr_beta_C
Other DBs
NCBI-GeneID: 110089954
NCBI-ProteinID: XP_020669015
UniProt: A0A6J0VBX3
LinkDB
Position
Unknown
AA seq 1120 aa
MTKMPRNRAFSEPEYSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGSCLCLPRFMRLTF
APESLENLYQTYFRRQRHETLLVLVVFAALFDCYVIITCTVVYASEKLAPILAASVGLAT
QILLFVLCKFELLPDRVTRKFVPYVLWILIVAQIFCYLGLNFARYHEASDTVGWQAFFVF
SFFLTLPLRLTPIVLISSISCGIHTLVLGVTIAQQQQEVKVAYEENLLWQILSNVAIYLC
TICVGIMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDM
KKDASQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLA
ARYHQLRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTNVDMRVGV
HSGAVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGDG
GSRCEYLKEKGIVTYLILLPEQPLKNGINGVKLSVSSSHGNSPQLINTKECNGSINTTCT
SPDEAEELDTKVVNPSFPNPRRRLRLRDLAERVVDASENEQELNKLLNEALLERESVQAL
KGRSTFRLSLRFIDPEMETRYSVEKEKQSGAAFSCSCVVLLFTAVVEIFIDRRLVANYVT
FVVGEVLLLILTLCSLAAIFPRVFPRKLVAFSTWIDRTRWARNTWAMSAIFILTMADIVD
MLSCQQSYTFHNGTTPVLSHGGCVENPKYYSYIAVLALIATIMLVQVSHMVKLTLMLMIT
GAVGVVNILAWQQIFDEYDEKRFRESQYLMVASKYSMTVMISVMMLSFYYFSRHVEKLAR
TLFLWKIDVHDQKERVYEMRRWNEALVTNMLPDHVARHFLGSKKRDEELYSQSYDEIGVM
FASIPNFADFYTEESINNGGIECLRFLNEIISDFDALLDDPQFRCITKIKTIGSTYMAAS
GVTPDANTNSYNNAVKKEDLSEKERWQHLADLTDFALAMKETLMNINYQSFNNFMLRIGM
NKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLVLKEYGFRFVRRG
HIYVKGKGDLLTYFMKGREKQGSFVNGSCVTLPHQVVDSS
NT seq 3363 nt   +upstreamnt  +downstreamnt
atgaccaagatgccccggaacagggccttctccgagcccgaatattcggcagaatattct
gccgactattcagtcagcttgccctccgaccccgagcacggggtgggccggacccatgag
gtgaccgtcaggagctccggctcgtgcctctgcctgccgcgttttatgcgcctcacgttc
gccccggagtccctcgagaacctctatcagacctacttccggcgacagcgccatgagacc
cttctagtcttggtggtcttcgctgcccttttcgactgctacgtgatcattacgtgcacg
gtggtctacgcctcagagaagctggcccctattttggccgcctcggtgggcctggcgacc
cagatcctcctcttcgtcctatgcaagttcgaactcttgccagacagagtcacccggaag
ttcgtgccttacgtcttgtggatcctcatcgtggcccagatattctgctacctggggctg
aacttcgcccgctaccatgaggccagcgacacggtgggctggcaagccttcttcgtcttc
tccttcttcctcaccctccccttgcgcctgacgcccatcgtcctgatctcgtccatctcc
tgcgggatccacacgttggtactgggagtgaccatcgctcaacagcagcaggaggtgaaa
gtggcctatgaagagaacttgctgtggcagatcttgtccaatgtggccatctacctgtgt
accatctgtgtgggcatcatgtcctactacatggcggaccggaagcaccgcaaagccttc
ctggaagcgcggcaatctctcgaagtcaagctgaatctcgaggaacagagccagcagcag
gaacggctgatgctttctattttgcccaagcacgttgccgatgagatgttgaaggacatg
aagaaagatgcaagccagaaggagatgcaacagtttaacaccatgtacatgtaccgccat
gagaacgtcagcatcctcttcgctgacattgttggtttcacacaactgtcgtccgcctgc
agcgcccaagaattggtgaagcttctgaacgaactttttgctcgctttgataaactagca
gcgaggtaccaccagctacggatcaagatcctaggggactgctactactgtatttgtgga
ctgcccgactaccgcgaagaccacgccgtttgttccatcatgatgggtcttgcgatggtg
gaggctatttcttacgtacgagagaagaccaagacgaacgtcgacatgcgtgtcggtgtg
cacagtggcgccgttctgggcggggtcctggggcagaagcgttggcaatatgacgtctgg
tccaccgatgtgaccgtggctaacaaaatggaagccggagggatcccagggcgtgtgcac
atttcccagagcaccatggactgcttgaagggagagtttgaggtggagccaggagacggc
ggatcacggtgcgaatacctgaaggagaaagggattgtgacttacctcatacttctcccc
gaacagccactcaagaatgggatcaacggggtgaaattgtccgtctcgtcttcccacggg
aactctcctcagctgatcaacaccaaagaatgcaacgggagcataaacacgacctgcacg
tccccagatgaggcagaggaattggacaccaaggtggtgaacccttccttccccaaccct
cggagacgcctgcgcttgcgtgacctggcagagagagtggtggacgcttcggagaacgag
caggaactcaacaagttgctgaatgaggccttgctggagagggagtccgtgcaagcactg
aagggcagatccaccttccgcctgtccttgcgctttattgacccagagatggagacccgt
tactccgtggagaaagaaaagcagagcggggcagccttcagctgttcgtgtgtcgtcctt
ctcttcactgctgtggtggaaattttcatcgatcggaggttggtggccaactacgtgacc
tttgttgtcggtgaggttctcttgcttatcttgaccctttgctctttggctgccatcttt
cccagggtttttcctagaaagctggtggctttttctacgtggattgaccggacccgatgg
gccaggaatacatgggccatgtccgccatttttatccttaccatggcagacattgttgat
atgctcagttgccagcagtcttacacctttcacaacggcacaacgcccgtgctgtctcac
ggcggttgtgtggagaaccccaagtactacagctacatcgccgttttggcgctcatcgcc
accatcatgctggtacaagtgagccacatggtcaaactcaccctgatgttgatgatcaca
ggggccgtgggggtggtgaacatcctcgcctggcaacagatctttgacgaatacgacgag
aagcgattccgagagagccaatacttaatggttgcgtccaagtattccatgacggtgatg
atttctgtgatgatgctcagtttctactatttctcccgccatgtggagaagctggctagg
actttattcctatggaagattgacgtccatgatcagaaagaacgtgtctatgagatgaga
cgctggaacgaggccctggtcaccaacatgctgccggatcacgtggcgcgacacttcctg
ggctccaagaaacgggatgaggaactgtacagccagtcgtacgacgagatcggcgtcatg
tttgcctccatcccaaattttgccgacttctatacagaggagagcatcaacaacggcggg
attgagtgcctgcgcttcctcaacgagatcatctcggatttcgatgccctcctggacgac
ccccagttccggtgcatcaccaagatcaaaaccatcggcagtacctacatggcagcttct
ggtgtgaccccagatgccaacaccaacagttataacaacgctgttaagaaagaagatctt
tccgaaaaagagcgctggcaacacttggcggatctcacagactttgccttggccatgaaa
gagaccttgatgaacatcaactaccagtccttcaataacttcatgctgcgaataggcatg
aacaaaggagccgtcctggctggagtcatcggtgcccgcaagccacactatgacatttgg
gggaacacggtgaacgtggccagccggatggaatcgacgggcgtcatgggaaacatacag
gttgtggaagagacccacctcgtcctgaaggagtacggcttccgcttcgtgcgccgaggg
cacatctacgtcaaaggcaaaggcgacctgctgacgtacttcatgaaagggcgcgagaag
cagggctccttcgtcaacggctcctgcgtgaccctgccccaccaagtggtcgacagctct
tga

DBGET integrated database retrieval system