KEGG   Pogona vitticeps (central bearded dragon): 110090137Help
Entry
110090137         CDS       T05000                                 

Gene name
GAA
Definition
(RefSeq) LOW QUALITY PROTEIN: lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00052  Galactose metabolism
pvt00500  Starch and sucrose metabolism
pvt01100  Metabolic pathways
pvt04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110090137 (GAA)
   00500 Starch and sucrose metabolism
    110090137 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110090137 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvt04147]
    110090137 (GAA)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110090137 (GAA)
Exosome [BR:pvt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110090137 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 110090137
NCBI-ProteinID: XP_020669335
LinkDB All DBs
Position
Unknown
AA seq 815 aa AA seqDB search
MVNLTTTETGYTAHLTRDRPTFMPDDIMNLQLDVVFETESRVHFMLKDPANKRYEVPLET
PQTTNKASSMLYSVQFSDDPFGLVILRNSSKRVLLNTTVAPLFFADQFLQISTSVPSPFI
SGLGEHLTSLILDVNWTKVTLWNRDVLPVPSANLYGSHPFYLALEEGGLAHGVFLLNSNA
MDVILQPSPALTWRTTGGILDFFVFLGPDPKSVVRQYMDVIGYPFMPPYWALGFHLCRWG
YTSTAVTREVVKNMTAAHFPLDVQWNDLDYADAKRDFTFNQDGFSDMPQMVNDFHRQGRR
YVMIVDPGISSSGPSGSYKPYDEGLKXGVFILNATGQPLIGKVWPGPTAFPDFTNPETQR
WWQDMVKDFHDQVPFDGMWIDMNEPSNFVEGSLEDCPPNKLENPPYVPGVLGGSLKSRTL
CASSKQYLSSHYNLHNLYGLTEAIASHDALVKVRGKRPFVISRSTFASHGRYAGHWTGDV
LSNWEHLYYTIPAVLLFNFYGVPLVGADVCGFVGNTSEELCVRWTQLGAFYPFMRNHNDH
KNMPQEPYVFSPKAQQAMRSALFLRYLLLPYLYTLFHKAHSAGETVARPLYLEFPEDPNT
WKVDRQFMWGSGLLITPVLEAGKTEVSGYFPPGTWYNPLTGSTIHSKGQWVLLPASLDTI
NAHVRAGCILPLQEPAFTTTESRKNGMILVVALTEDGVARGDLFWDDGEGLLTFEKGDYT
QIAFLAGNGVLVNEIVQLNSQVDGLQLKDVMVFGILSPPHKVLANGVPVSDFSYRTDTKV
SRSQGCPVRLAWQKEVPQQFNTQGLLWMWHTRLEL
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacttgacaaccactgaaacgggctatactgcccacttgacccgagacaggccc
actttcatgccggatgacataatgaacttgcagctcgatgtggtctttgaaacggagagt
agggttcattttatgcttaaggatccagctaacaagcgctatgaggttcctttagaaacc
ccgcaaacaaccaacaaggcatcttcaatgctctactctgtacagttctcagacgatccc
tttggcctcgtaatccttcggaattcaagcaagcgggttctgctcaatacaacagtggcc
cctctgtttttcgcggaccagttcctgcagatctccacctcagtaccatcacctttcatc
tctggcctgggtgagcacttgacctcactcattcttgatgtcaattggacaaaggttacc
ctgtggaatcgggacgtactgcctgtgccttctgccaacttgtatgggtcacaccccttc
tacctggccttggaagaaggtggtttagctcatggagtttttctgctaaatagtaatgct
atggatgtgatcctccagcccagcccagctctgacatggagaacaactggaggaatcctg
gacttctttgtcttcctgggcccagatccaaagagtgtggtgcgccaatatatggatgtc
attgggtacccgttcatgcccccctactgggccctaggatttcacctctgtcgctggggt
tacacttccactgctgtcactcgggaggtagtgaagaacatgacggcagcacacttcccc
ttggatgtgcagtggaatgacctagattatgcagatgcaaagagagacttcactttcaac
caggatggtttctcagatatgccgcaaatggtgaacgatttccatcgtcagggtcggagg
tacgtcatgattgtggatccaggtatcagcagttccggcccttctggcagttataagcct
tatgatgaaggcctaaagtgaggggtcttcatcttaaatgcaacaggacagcctctgatt
gggaaggtttggcctgggcccactgccttccctgacttcaccaatccagagacacagcgg
tggtggcaagacatggtcaaggatttccacgaccaagtgccttttgatggaatgtggatt
gacatgaacgagccatcaaattttgtggaaggttccctggaagactgtcctcccaacaag
cttgaaaatcccccttacgtgccaggtgtactaggtggatccttgaagtcacgaactctt
tgtgcttccagtaagcaatatctatcttcacactacaacctccacaatctatatgggcta
acagaagccatcgcatcacatgatgctttggtgaaagttcgaggaaagcgcccatttgtg
atctcgcgctccacctttgccagccacggccgctatgctggccactggactggagatgtc
ttgagcaactgggaacatttatactacaccataccagcggtgctgctgtttaacttctat
ggtgtgccactggttggtgctgatgtctgcggttttgtgggcaacacatcagaagagctc
tgtgtgcgttggactcaactgggtgccttctacccctttatgcgaaaccacaatgaccat
aagaacatgccccaggagccctacgtcttcagcccaaaggcccagcaggccatgagaagc
gccctcttcctgcgctacttactgctgccttacctctacaccctcttccacaaagctcac
tctgcaggcgagacggttgcccggcccctttatctagagttcccagaagatcccaatacg
tggaaggtggaccggcagttcatgtggggatctgggcttctcatcactcctgtgttagaa
gcagggaagacagaagtcagtggttacttccctccagggacgtggtacaaccctctgact
ggatccaccatacacagcaaggggcaatgggttctcctaccagcttcacttgacaccatc
aacgcccatgtacgggcaggctgcatcttacccttgcaggaacctgctttcacaaccaca
gaatcccgcaaaaatggaatgattctggtggtggctctgacagaggatggggtggccaga
ggtgacctattctgggatgacggtgaaggcctgctgacctttgaaaagggtgattacaca
cagatcgcttttctggcaggaaatggtgtgctggtgaatgagattgtgcagctcaacagc
caggtggatgggctacagctcaaagatgtgatggtttttggtatcctcagtcctcctcat
aaggtcctggcaaatggcgtcccggtctcagacttttcctaccgcacagataccaaggta
agcaggtctcagggctgtcctgttcggcttgcgtggcaaaaagaggttccacagcagttc
aacactcaaggccttctgtggatgtggcacacgcgtttggagctataa

DBGET integrated database retrieval system