KEGG   Pogona vitticeps (central bearded dragon): 110090570Help
Entry
110090570         CDS       T05000                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00020  Citrate cycle (TCA cycle)
pvt00190  Oxidative phosphorylation
pvt01100  Metabolic pathways
pvt01200  Carbon metabolism
Module
pvt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pvt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pvt_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110090570 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110090570 (SDHA)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110090570 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110090570
NCBI-ProteinID: XP_020669890
LinkDB All DBs
Position
Unknown
AA seq 661 aa AA seqDB search
MAALVLRRLRRVPLLHGQGPAACQALSRNFHFTVYGKKNVSAKISDSISTQYPVVDHEFD
AVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHF
YDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGIIALCIEDGT
IHRLRAKNTVIATGGYGRTYFSCTSAHTCTGDGTAMITRAGLPCQDLEFVQFHPTGIYGA
GCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDH
VYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGVPTNYKGQVIT
HVNGKDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCKPGEPVPP
VKPNAGEESVANLDKLRFANGSMRTSELRLNMQKTMQSHAAVFRTGSVLQEGCEKISSIY
NSLDDLKTFDRGIVWNTDLVETLELQNLMLCSLQTIYGAEARKESRGAHAREDYKVRIDE
YDYSKPLQGQQKKPFDQHWRKHTLSYVDIKSGKVTLEYRPVIDKTLNEEDCAMVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgttagttttgcggcggctgcggcgcgtcccgctgctccatgggcaaggacca
gcagcttgccaggctctgtctcggaattttcacttcacggtttatgggaagaaaaatgtg
tctgccaaaatatcggattcgatttcaacacagtatcctgtagtggaccatgagtttgat
gctgttgtggtgggtgccggaggtgcaggtttgcgagctgcgtttggcttgtctgaagct
ggatttaatacagcatgtgttacaaaactgttccctacacggtctcatacagttgctgcc
caaggaggaatcaatgctgctttggggaatatggaagaggataactggagatggcacttc
tatgatacggtgaaaggttctgattggttaggagaccaggatgctattcattacatgact
gaacaagcccctgcttcagttattgagctggagaattatggtatgccatttagcaggaca
gaagatgggaagatctaccagcgtgcctttgggggacagagtctgaagtttggtaaaggg
ggacaggcacatagatgctgttgtgtggctgatcggactggccattcactgctgcacacg
ctttatggacggtcccttaggtatgacaccagttactttgttgaatactttgcccttgac
cttcttatggagaatggagaatgtcgtggtattattgcactttgtatagaagatggcacc
attcatcgtttaagagcaaagaatacagttatcgccactggtggatacggacgcacttac
tttagctgtacttcagctcacacctgtactggagatgggacagctatgatcacacgggca
ggtctgccttgtcaggatttggagtttgtgcagttccatccaacagggatttatggagct
ggttgccttattactgaaggctgtcgtggtgaaggaggcattctaattaacagtgaaggt
gaacggtttatggagagatatgctcctgttgccaaagatcttgcttcaagagatgttgtg
tctcgttctatgactattgagatccgtgaaggaagaggatgtggtccagaaaaagatcat
gtgtacttgcagttgcatcatttgccacctcagcagctggcaacacgtcttcctgggatt
tcagaaactgcaatgatatttgctggtgtagatgtcacaaaagaacccattcctgttctg
ccaactgtgcattacaatatgggaggtgttcctacaaactacaaaggacaggtgattaca
catgtaaatggcaaagatcaagtagtacctggtttgtatgcttgcggtgaagctgcctgt
gcctccgttcatggtgctaatcgtcttggagcaaactctctcttggacttggtagtgttt
ggccgtgcctgtgctcttagtattgcagaatcctgcaaacctggagaaccagttccacca
gttaaaccaaatgcaggtgaagaatctgtcgcaaacttggacaaactacgctttgccaat
ggaagcatgagaacatcagaattgaggcttaatatgcaaaagacaatgcaaagccatgct
gcagtgttccgcacaggttctgtcctacaggaaggttgtgagaaaatttccagcatatat
aacagtttggatgacttgaagacatttgacagaggcattgtgtggaatactgacttggtg
gagactttggaactacagaatctaatgctttgttccttacaaactatttatggtgcagaa
gctcggaaagagtcacgtggtgctcatgctagggaggattataaggtaagaatagatgaa
tatgactattctaaaccactccaaggacaacagaagaaaccatttgatcagcattggaga
aagcataccctctcttatgtagacatcaagagtggaaaggttactctggaatatagacct
gtaattgacaaaactctgaatgaagaagactgtgcaatggttccacctgctattcgctcc
tattag

DBGET integrated database retrieval system