KEGG   Pogona vitticeps (central bearded dragon): 110090616Help
Entry
110090616         CDS       T05000                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110090616 (HDAC6)
Protein phosphatases and associated proteins [BR:pvt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110090616 (HDAC6)
Messenger RNA biogenesis [BR:pvt03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110090616 (HDAC6)
Membrane trafficking [BR:pvt04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    110090616 (HDAC6)
Chromosome and associated proteins [BR:pvt03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110090616 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 110090616
NCBI-ProteinID: XP_020669972
LinkDB All DBs
Position
Unknown
AA seq 1094 aa AA seqDB search
MASDLGDAAVLDLPSLLSLKTQAPLKKANRKGGLPEAKRKGRAKRLNKDAEELLSGMQRL
DLTTECTAPVGTGLIWDERMTRFHCTWDESFPECPERLMAIHEKLLQCGLLERCIPVATR
EASEEEILLAHSQEFLTLMKSTETMSEAELKSLSEKYDSVYLHPNSYRCACRAVGSVLEL
VEKVLAGELRNGLAVIRPPGHHAQYNNMDGYCMFNTVGIAAQYVRQKLGFERVLIVDWDV
HHGQGIQYLFEDNPSVLYFSIHRYEGGRFWPHLPESDSHAVGRGRGEGYNINVPWNQIGM
RDADYLSAFLHILLPVALEFQPQLVLVAAGFDSVVGDPKGEMAATPACFAHLTHLLMPLS
GGKLVLSLEGGYNHQSLAEGTCSVLKALLGDPCPLLESPLAPCSSALHSVSQTLAVHSKY
WKNLRRISSDVHQEDGGEIALPVADPLPVSEILSKSAAELLRPHPPSCTGLVYDEKMTEH
YNMWDSQHPELPQRVSRIFQRHGELRLTERCCRLPARLASEEELRMCHSLAYVETVKSTA
TMKPRDLHRQGDQYNSIYICASSYECARLAAGSAFSAVEAVLSGQVRNAVAIVRPPGHHA
ESDTACGFCFFNSVALAARYAQRLAERPMRVMILDWDVHHGNGTQHMFEDDPSVLYVSLH
RYDNGLFFPTSEDADYDRVGLGPGKGYTLNVPWNCPRMGDPEYMAAFHQIVMPVSYEFNP
ELVLVSAGFDAARGDPLGGCLVTPECYAHMTHLLLGLAGGKVVLVLEGGYNLESISESMT
MCTRSLLGDPPPPLGRLKAPHPSALQSLAQVASVHRKYWASLRLEVSALVCEKPRTRAGK
GTFPADEAPVNSCQKLPQSPVVQPVEPVDAAAMALDSLQLEDNLVEEGETASSSLSPDSS
SVGEEAQSKVGGSSEESAEDIQREGMSRESSSGEVESHEKEAEGSPLQLPATATESGLLD
EATGGYTITCEVREGDLTDTGMFYAVTPLLWCPHLSSVLPVPPGGLNVLEPCAECGSMAE
NWVCLVCYKVCCGRYINQHMVAHNSESGHPLVLSFADLSAWCYECQAYVHHPTLFEAKSL
AHKMMFGVDMAVPS
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagatttaggagatgccgctgttttagatcttccgtctttgctgtctctgaag
actcaggcaccactgaaaaaagctaacagaaaaggtggattgccagaggccaagcggaaa
ggacgggccaagcggctgaacaaagatgcagaggaactgctctcgggcatgcagcgtttg
gaccttaccaccgaatgcacagcaccagtgggaacaggcctgatttgggatgagcggatg
acacggtttcattgcacatgggatgagagctttccagaatgcccagagcgactgatggcc
atacatgagaaactgctgcagtgtggactcctggagcgctgcatcccagtggcgacccga
gaagcttctgaggaagagatcctgttggctcacagtcaggagtttctcacactgatgaaa
tcaactgaaacgatgagtgaggctgagctgaaatctttatcagaaaagtatgattcagtc
tatctgcacccaaattcctaccgctgtgcctgccgtgctgttggttctgtccttgaactc
gtagagaaagtgttggctggggagcttcgtaatgggcttgctgtcatcagaccccctgga
caccatgctcagtacaacaacatggacggctactgcatgttcaacactgtaggcattgca
gcccaatatgtgcgacagaaattggggtttgagcgggtgcttatcgtcgattgggatgtg
catcacggacaaggcatccagtacctttttgaggacaatcccagtgtcctttacttctcc
attcatcgctatgaagggggcaggttttggccccatcttcccgaatcagacagtcatgct
gtgggcagaggccggggagagggctacaacatcaatgtgccctggaaccagataggaatg
cgggatgctgactacctctctgcctttttgcatatcctgctgcctgtggccttagagttc
cagccccagctggtcctggtcgctgctggttttgactctgtggttggtgaccccaagggg
gaaatggctgccaccccggcgtgctttgctcacctgacacacttgctgatgccactgtct
ggaggcaagcttgttctgtctctggagggtgggtacaatcaccagtccttggcagaagga
acctgctcagtgctcaaggctcttctcggagatccctgtcctctgctggaatcacctctt
gcaccttgcagcagtgccctccattcagtgtcccagactctagcggttcacagcaaatat
tggaagaacttgcggaggatcagttcagatgtgcaccaggaagatggaggagaaatcgcc
ttgccagtggccgaccccctgccagtctctgagatcctgtccaagtcagcagctgaactg
ttgcgacctcatcccccttcctgcacagggctggtctatgatgagaagatgacagagcat
tacaacatgtgggacagccagcatccagagttgcctcaaagagtctcccggatcttccag
cgccatggagagctgcgtctcacagagaggtgctgccggctcccagctcggcttgcctca
gaagaagagttgcggatgtgccacagcttggcctatgtggagacagtgaagtcgacggcc
accatgaagccacgtgacttgcatcgccagggtgaccagtacaattctatctacatctgt
gccagctcctacgaatgcgccaggctggcagctggttctgccttcagtgcagtggaggct
gtgctctctgggcaggtccgaaacgcagtggcaatcgtccggccacctggacaccacgca
gaatcagacaccgcttgtggcttctgtttcttcaattctgtggccttggcagcacggtat
gcccagcgcttggctgagcggcctatgagggtgatgatactcgattgggatgtccaccat
ggcaatgggacacagcacatgtttgaagatgatcccagcgtcttgtacgtctcgctccac
cgttacgacaatggccttttcttccccacctctgaggatgctgactatgaccgggtgggt
ttggggcctggcaaggggtacaccctgaacgtgccttggaactgccctcgcatgggagac
cccgagtacatggctgccttccaccagatcgtcatgcctgtcagctatgagttcaatcca
gaactggtcctggtttctgctggttttgatgctgctcgaggggaccctctcggtggatgc
ctcgtgacccctgaatgctatgcacacatgacccatctgctcttgggtctggcaggaggc
aaagtggtgcttgtgttggagggtggctacaacctggagtcaatctcggagtccatgacc
atgtgtacacgcagcttgctgggggatccgccaccccccttgggacgcctcaaggccccc
caccctagtgccctacagtctttggcccaagtggcttctgtgcaccgcaagtactgggca
agcctccgcctggaagtatctgctcttgtttgtgaaaagcccaggactagggctggaaag
ggcactttccctgcagatgaagctcctgtaaattcctgccagaagctgcctcaaagccct
gtagttcagcctgtggagcctgtcgatgctgcagccatggctttggattccctccagcta
gaagacaaccttgtggaagagggagagacggcttcaagctcgctctctcctgactccagt
tccgtgggcgaggaagctcagtccaaggttgggggctcctctgaagagtcagcagaggac
atccagagagaaggcatgtcaagagagagctcctctggtgaagtggagtctcatgaaaaa
gaagcagaagggagcccgctccaactccccgctacagcaactgagagtggtctactagat
gaagccacaggtggttatacaatcacctgtgaggtgcgtgaaggagatctgacagacaca
ggaatgttttatgctgtgactcccctactatggtgtccccacctcagctcagtgctgccg
gtgcctcctgggggtttgaatgtgctggagccctgtgcagagtgtggcagcatggctgag
aactgggtctgcctggtttgctataaggtctgctgtggccgctacataaatcagcacatg
gttgcgcacaactcagaatctgggcaccctctggtgctcagttttgcggacctctctgcc
tggtgctatgaatgccaagcttatgtccaccacccaactctctttgaagccaagagcctg
gctcataagatgatgttcggagtggacatggctgtaccttcctaa

DBGET integrated database retrieval system