KEGG   Pogona vitticeps (central bearded dragon): 110091524Help
Entry
110091524         CDS       T05000                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00500  Starch and sucrose metabolism
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110091524
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     110091524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 110091524
NCBI-ProteinID: XP_020671338
LinkDB All DBs
Position
Unknown
AA seq 512 aa AA seqDB search
MKIFLLLVAVELCWAQYNPNLESGRTSIVHLFEWRWADIALECERYLAPNGYGGVQISPP
NENIIITNPWRPWWERYQPISYKLCSRSGSEDELRNMVTRCNNVGVHIYVDAVVNHMCGS
GGGAGTHATCGSYFNAGTRDFPAVPYSAWDFNDGKCHTGSGDIENYGDIYQVRNCRLVSL
LDLALEKDYVRSTVANYMNTLIDMGVAGFRLDASKHMWPGDIKAFLDKLHNLNTKWFPEG
TKPFIFQEVIDLGGEPITSDQYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLRNWGEGWG
FMPSDKALVFVDNHDNQRGHGAGGASILTFWDPRLYKMAVGFMLAHPYGFTRVMSSYRWE
RNFVNGQDQNDWIGPPSNPDGSTKSVPINPDTTCGDNWVCEHRWRQIRNMVIFRNVVNGE
PQVNWWENGNNQVAFGRGNKGFIIFNNDDWDLSINLQTGLPGGTYCDIISGEKEGNRCTG
ITVNVQNDGMGYFQIRTSAEDPFIAIHVNAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttttcttcttctggtggctgttgagctttgctgggctcaatataacccaaat
ctagagtctggaaggacatctattgtccacctctttgaatggcgttgggcagacattgct
cttgaatgtgaacgatacttggcaccaaatggatatggtggagttcagatctccccacca
aatgaaaatattatcattacaaatccatggaggccatggtgggaaagataccagcccatc
agctacaagctatgctcacgatctggatctgaggatgagcttagaaacatggtgacccgg
tgcaacaacgttggagtccatatttatgtggatgctgtcgtcaaccacatgtgtggaagt
ggaggtggagctggtacccatgcaacatgtggaagctattttaatgcagggacccgggat
tttcctgctgttccttattcagcttgggatttcaatgatgggaaatgccatactggaagt
ggagatattgaaaattatggtgatatttatcaggttcgcaactgtcgccttgttagtctt
ctcgatctcgcactcgagaaggactatgtccgctccactgttgcaaattatatgaacacc
ctgatagatatgggagttgcaggattccgacttgatgcttcaaagcacatgtggcctggg
gacattaaggctttcttagacaagctacataatctgaatactaaatggtttcctgaaggg
acaaaaccattcatttttcaagaggtgattgatctgggaggagagccaatcacgtctgat
caatactttggcaatggtcgggtaactgaattcaaatatggtgcaaaactagggacagtc
atccgcaagtggaatggagaaaagatgtcttatttgaggaactggggagaaggctggggt
tttatgccttctgacaaagccctagtctttgttgataatcatgacaaccagaggggacac
ggtgctggaggagcttccattttgactttctgggatcccaggctttacaaaatggcagtt
ggatttatgcttgctcacccatatggctttacacgtgtaatgtcaagttaccggtgggaa
aggaattttgtgaatggacaggatcagaatgactggattgggcctccaagcaatcctgat
gggtcaactaaatcggtcccaatcaatccagacaccacctgtggtgataactgggtctgt
gaacatcgatggcgtcaaataagaaacatggttattttccgcaatgtagtcaatggagag
cctcaagtcaactggtgggaaaatggtaacaatcaggtggcattcgggcgtggcaacaaa
ggattcatcatctttaataatgatgattgggacttatctataaatctgcaaactgggctt
cctggaggcacgtactgtgatatcatttctggggagaaagaggggaacagatgcactggc
attacagttaatgtccaaaatgatggcatgggctattttcagatcaggacctcggcagaa
gacccatttattgctattcatgtgaatgctaaattgtaa

DBGET integrated database retrieval system