KEGG   Phaseolus vulgaris (common bean): PHAVU_002G207600gHelp
Entry
PHAVU_002G207600g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00061  Fatty acid biosynthesis
pvu00780  Biotin metabolism
pvu01100  Metabolic pathways
pvu01212  Fatty acid metabolism
Module
pvu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PHAVU_002G207600g
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PHAVU_002G207600g
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pvu01004]
    PHAVU_002G207600g
Enzymes [BR:pvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PHAVU_002G207600g
Lipid biosynthesis proteins [BR:pvu01004]
 Fatty acid synthase
  Component type
   PHAVU_002G207600g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 18638606
NCBI-ProteinID: XP_007159088
UniProt: V7CLI7
LinkDB All DBs
Position
2
AA seq 312 aa AA seqDB search
MLGPSKNHGLVFTLHGVKPKMLDHLKIMLSQASTKGAFSFYIIIVEQTTSNHEKPPLAIA
FVALFLTFSHSTSYVITNTSLTVQSQAQTMTFCALSNTFISPYFPPSHSHQSKFSSFRFF
SSRSQPLATQLRKTITTTRFTTFCSLDAANAPKQDTPIEFRYPAFPTSLDINKILAILPH
RFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVML
QPEVGGSRQNFFFAGIDKVRFRKPVIAGDTLVMRMTLTKLQKRFGIAKMEGKAYVGGEVV
CEGEFLMATGSE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtccaagcaaaaaccatgggttggtgttcaccctccatggtgtcaagccgaag
atgcttgatcatttgaaaattatgttgtcacaggcgagcacaaaaggagcatttagtttt
tacataattattgttgaacaaacaacgtccaaccacgaaaaaccgccattagcgattgca
tttgtagcattgtttcttactttctctcattcaacatcttacgtaataaccaatacatca
ttaacagttcagagccaagctcaaacaatgacattctgtgctctctccaacactttcatc
tctccctatttcccaccatctcattcccatcaatccaaattctcatctttcagatttttc
agctccagatcgcagcctctggctacccagttgaggaaaaccatcacaacaacacgcttt
acaacgttttgttctctggatgctgcaaatgcaccaaaacaagacaccccaattgaattt
aggtaccccgcatttccaacatcgttggacatcaacaagattctcgcaattctgccacac
cggtttccatttcttctagtggatagagtgattgaatacaatcctggagtttctgcagtg
gccataaagaatgtaacaataaatgataacttttttcctggacattttccagaaagacca
atcatgcctggtgttcttatggttgaggcaatggcccaagtaggtggcttggttatgttg
cagcctgaagttggaggttctcgtcagaatttcttctttgctggaatagacaaagtgcga
ttcaggaagccagtgattgcaggagacacgttagttatgagaatgacactaacaaaactg
caaaagcgatttggaatagcaaagatggaagggaaagcatatgttggaggtgaagttgtg
tgcgagggagagtttttgatggccactgggagtgaataa

DBGET integrated database retrieval system