KEGG   Phaseolus vulgaris (common bean): PHAVU_002G308400gHelp
Entry
PHAVU_002G308400g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00010  Glycolysis / Gluconeogenesis
pvu00051  Fructose and mannose metabolism
pvu00052  Galactose metabolism
pvu00500  Starch and sucrose metabolism
pvu00520  Amino sugar and nucleotide sugar metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
pvu01200  Carbon metabolism
Module
pvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pvu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHAVU_002G308400g
   00051 Fructose and mannose metabolism
    PHAVU_002G308400g
   00052 Galactose metabolism
    PHAVU_002G308400g
   00500 Starch and sucrose metabolism
    PHAVU_002G308400g
   00520 Amino sugar and nucleotide sugar metabolism
    PHAVU_002G308400g
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PHAVU_002G308400g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pvu04131]
    PHAVU_002G308400g
Enzymes [BR:pvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PHAVU_002G308400g
Membrane trafficking [BR:pvu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PHAVU_002G308400g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18639644
NCBI-ProteinID: XP_007160283
UniProt: V7CQ02
LinkDB All DBs
Position
2
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMISSRKWSRAIAILKEFEEKSGTPLAKLRQVAD
AMDVEMHAGLASEGGSKLNMLISFVDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKG
VIGQEFAEVSIPPQLMTGTSEALFDFIASALAKFVAAEPEGFHPPPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFNIEDTVGEDVVGELTKSMEKIGLDMRIAALVNDTIGTLAGGRF
YNQDVIAAVILGTGTNAAYVERAHAIPKWHGLIPKSGDMVINMEWGNFRSSYLSLTEYDL
ALDAESLNPGEQIFEKLISGMYLGEIVRRALLKMAEEADFFGDTVPPKLKVPFILRTPDM
SAMHHDTTSDLKVVGNKLKDILEISNTSLKMRKIVVALCDIVATRGARLAAAGILGILKK
LGRDTVKVGEKQKSVIALDGGLFEHYAKFRECLESTLKELLGEEAAETIVIEHANDGSGI
GAALLAASHSQYLGVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtcgcggtgggagctgcagttgtctgcgccgccgccgtttgcgccgcggcg
gcgctggtggtgcgccaccgcatgattagttcccgcaagtggagtcgcgccatagcgata
ttgaaggagttcgaggaaaagagtgggaccccacttgcaaagcttagacaagtggctgat
gccatggatgtcgagatgcacgcaggtctcgcatctgaaggtggtagcaagcttaacatg
ttgatcagtttcgtcgataatctccctactggggatgaggaaggactctattatgcactg
gaccttggtggcacaaacttccgcgtccttcgtgtacatctgggtgggaaagacaaaggt
gttattggccaggagtttgcagaagtttcaattcctccacaattgatgactggtacttca
gaggcattatttgattttatagcatcagctcttgccaagtttgttgctgcagaaccagaa
ggttttcatcctccccctggcagacaaagagaactgggttttacattctcattcccagtg
aggcaaacatcaatttcatctgggactctaattaagtggactaaaggttttaatattgaa
gatacggttggtgaagatgtggtaggagaactaaccaagtccatggaaaaaattgggctg
gatatgcgaattgctgctctagttaatgataccattggaacattagctggaggcagattc
tacaatcaggatgtaattgctgctgtgattcttggtactgggacaaatgcagcatatgta
gaacgtgcacatgctattccaaaatggcacggccttataccaaaatcaggagatatggtt
ataaacatggagtggggcaatttccgatcatcatatctttcccttacagaatatgatcta
gctcttgatgctgagagtttaaaccctggagaacagatttttgagaaattgatttcgggc
atgtatttgggggagattgttaggagagctttgctgaagatggccgaagaagctgacttt
tttggagatactgttccacccaaattgaaagttcctttcatacttaggacacctgacatg
tcagccatgcaccacgacacaacttctgatctgaaagtggttggaaacaaattaaaggat
atattagagatctcgaacacatctctaaaaatgaggaagattgttgtggcactatgtgac
attgttgctactcgcggggcccgccttgctgccgctggtattttgggcatcctcaagaaa
ctaggaagagacacagttaaggttggggagaagcaaaagtcggtgattgcattggatgga
ggattgtttgaacactatgctaaattcagagaatgcctggagagtacactgaaggaattg
ctgggagaggaggctgctgagaccattgtcattgagcatgctaatgatggctcaggcatt
ggtgcagcccttctggcagcttctcactcccagtatttgggagtggaggagtcttaa

DBGET integrated database retrieval system