KEGG   Phaseolus vulgaris (common bean): PHAVU_003G052500gHelp
Entry
PHAVU_003G052500g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00010  Glycolysis / Gluconeogenesis
pvu00053  Ascorbate and aldarate metabolism
pvu00071  Fatty acid degradation
pvu00280  Valine, leucine and isoleucine degradation
pvu00310  Lysine degradation
pvu00330  Arginine and proline metabolism
pvu00340  Histidine metabolism
pvu00380  Tryptophan metabolism
pvu00410  beta-Alanine metabolism
pvu00561  Glycerolipid metabolism
pvu00620  Pyruvate metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHAVU_003G052500g
   00053 Ascorbate and aldarate metabolism
    PHAVU_003G052500g
   00620 Pyruvate metabolism
    PHAVU_003G052500g
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PHAVU_003G052500g
   00561 Glycerolipid metabolism
    PHAVU_003G052500g
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PHAVU_003G052500g
   00310 Lysine degradation
    PHAVU_003G052500g
   00330 Arginine and proline metabolism
    PHAVU_003G052500g
   00340 Histidine metabolism
    PHAVU_003G052500g
   00380 Tryptophan metabolism
    PHAVU_003G052500g
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHAVU_003G052500g
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PHAVU_003G052500g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PHAVU_003G052500g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 18633957
NCBI-ProteinID: XP_007153639
UniProt: V7C8F3
LinkDB All DBs
Position
3
AA seq 535 aa AA seqDB search
MASPLRISRLISRSFSSTSFSARGGNSYLGPRLCKYSTAAAIEEPIKPAVQVEYTQLLID
GKFVDAASGKTFPTLDPRTGEVIAHVAEGHSEDIDRAVAAARKAFDHGPWPRMTAYERQR
ILLRAADLIEKHNDEIAALETWDNGKPYEQSAKIEIPMLVRLFRYYAGWADKIHGLTVPA
DGPYHVQTLHEPIGVAGQIIPWNFPLVMFAWKVGPALACGNTIVLKTAEQTPLSAFYVAK
LFLEAGLPPGVLNVVSGFGPTAGAALASHMEVDKLAFTGSTDTGKVVLQLAAKSNLKPVT
LELGGKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFVEKAKARA
LKRVVGDPFKGGIEQGPQIDSEQFEKILRYVRLGVESGATLETGGDRLGDKGYYIQPTVF
SNVKDDMRIATDEIFGPVQSILKFKDLGEVVQRANNSRYGLAAGVFTKNIDTANILTRAL
RVGTVWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNSLKNPAWL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcctctcagaatttcaaggctcatctctcgctccttttcttctacttccttc
tctgcacgaggtgggaatagttaccttggccccagactctgtaaatacagtactgctgcc
gccattgaagaacccattaaaccagcagtgcaagtggaatacacccaactcttaattgat
gggaaattcgtagatgctgcttctggtaaaacttttccaactttggatccaaggacgggg
gaagtgattgctcatgttgctgagggtcactctgaagatattgatcgagcggttgcagct
gcgcgcaaagcatttgatcatggtccatggcctaggatgacagcttatgaaaggcaaagg
atcttgttacgtgcagctgatctgattgagaagcataatgatgagattgcagcacttgag
acttgggataatggaaagccttatgaacaatctgctaagattgagattccaatgcttgtt
cgtctgttccgctactatgctggttgggcagataagattcatggtctaacagttccagct
gatggaccttatcacgtgcaaactttgcatgaacccattggtgttgcgggtcagatcatt
ccttggaacttccctcttgtcatgtttgcctggaaggttggaccagcgttggcctgtggc
aacaccattgttctcaaaacagctgagcagacaccattatctgctttctatgtagcaaaa
ctatttctcgaggctggacttcctcctggtgttttaaatgtggtttcaggatttggacca
actgctggtgctgctcttgcaagtcacatggaggttgataagcttgcttttactggttcc
actgatactgggaaagttgtccttcaattggcggctaaaagcaatcttaagcctgtaact
ttggagcttggtggaaaatccccgtttattgtgtgtgaagatgctgacatagatcaggct
gttgagctagcacactttgctttattctttaatcagggacaatgttgctgtgctgggtca
cgaacatatgtacacgaaagtgtatacgatgagtttgttgagaaagcaaaggctcgtgct
ttgaaacgtgttgttggcgatccattcaaggggggaatagagcaaggtcctcagattgat
tcagagcaattcgagaaaatcctgaggtatgtcagacttggggttgaaagtggggctacc
cttgaaacaggaggagacagacttggcgacaagggctactacattcaacctactgtcttc
tcaaatgttaaggatgacatgcggattgcaacggatgaaatctttggtccagtccaatcc
atattgaaattcaaggaccttggtgaggtagttcaaagagcaaataactcacgatatggg
cttgcagcaggagtgttcacaaagaacatagacactgccaacattttgactcgggcactg
agagtaggaacagtttggataaattgctttgacacatttgatgctgcaattccctttggt
ggttacaagatgagtggtcagggcagagaaaaaggagagtatagtcttaagaactacttg
caagtgaaggcagttgttaactccctgaagaacccagcatggctttga

DBGET integrated database retrieval system