KEGG   Phaseolus vulgaris (common bean): PHAVU_003G253200gHelp
Entry
PHAVU_003G253200g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00020  Citrate cycle (TCA cycle)
pvu00190  Oxidative phosphorylation
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
pvu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHAVU_003G253200g
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PHAVU_003G253200g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PHAVU_003G253200g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 18636020
NCBI-ProteinID: XP_007156038
UniProt: V7CCV5
LinkDB All DBs
Position
3
AA seq 620 aa AA seqDB search
MWRCVARANHQSLRSRVSRFFSSGGNSSYNVVDHKYDAVVVGAGGAGLRAAIGLSEHGFN
TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREA
PKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYG
QAMRHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQAASTILATGGYGRTYFS
ATSAHTCTGDGNAMVARAGIPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGER
FMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPQKDHIYLHLNHLPPDVLKERLPGISE
TAAIFSGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVITIKGDDPDAVVPGLMAAGETACA
SVHGANRLGANSLLDIVVFGRACANRVAEICRPGDKQKPLEKDAGMKSIAWLDKLRNSNG
SLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVKLKDRGLIWNSDLIE
TLELENLLINACITMHSAEARKESRGAHAREDFSKRDDENWMKHTLGYWENEKVRLDYRP
VHMNTLDDEVESFPPKARVY
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtggctcgtgcgaatcaccaatcactgagatctcgcgtgtcaagattt
ttctctagtggtgggaactcctcctacaacgtggtggatcacaagtacgatgcggttgtc
gtgggtgctgggggtgcagggttgagagccgccattggactttccgaacatggcttcaat
actgcttgcatcacgaagctcttcccaactcgttcgcatactgttgcagctcagggtggt
ataaatgctgcattgggaaatatgactgaagatgattggaggtggcacatgtacgacact
gtcaagggaagtgattggcttggggaccaagatgccatccaatatatgtgtagggaggca
ccaaaagcagtcattgaacttgaaaattatggactgccattttcacgaactgaagatgga
aaaatataccagcgtgcatttggtggtcagagcttgaactttggaaaaggtggtcaggca
tatcgttgtgcatgtgctgctgatcgaactggacatgctttactgcacactctctacggc
caagccatgagacataatacccagttttttgtggaatattttgcactagatctattaatg
aacagtgatggtagttgccaaggtgtgattgccttgaatatggaggatggaacattacac
cgtttccaagcagcttcaacaattttggccacagggggctatggtagaacatatttttct
gccacctcagcacatacatgcactggagatggcaatgccatggttgcacgtgctgggatc
ccacttgaggatttagagtttgtgcaatttcaccctacaggcatatatggagcaggctgc
cttatcacggaaggttctcgaggtgaaggcgggattcttaggaacagtgagggcgagagg
tttatggaacgttatgctcctactgcaaaggatcttgcatcaagagatgttgtttccaga
tcaatgactatggaaatccgggaaggccgtggtgtaggaccccagaaagatcacatctat
ctccacttgaatcacttacccccagatgttctcaaggagagactacccggtatctctgaa
acagctgctattttttctggcgtggatgttactaaggagcctattcctgttttgccaaca
gtgcattataacatgggtggtattcccacgaatcatcatggagaggtgattactattaaa
ggtgatgatccagatgcagtagttcctggattaatggctgcgggggaaacagcctgtgct
tcagttcatggtgccaatcggcttggtgcaaattcacttcttgacattgttgtttttggt
agagcttgtgcaaatagagttgcagaaatctgtaggccaggagataaacaaaagccttta
gagaaagatgctggaatgaaatcaattgcttggctagacaaattgagaaattcaaatggg
tcattgccaacttccaaaattcggttgaatatgcaacgagtaatgcaaaacaatgctgct
gtgttccgtacccaagaaacattagaagaaggttgtcaattaattgataaaacatgggag
agcttccatgatgtcaagttgaaggatcgaggtttgatatggaactctgacttgattgag
accttagagttggaaaatcttctgattaatgcctgcatcaccatgcactctgctgaagca
agaaaagagagtagaggtgctcatgcccgtgaggacttctcgaaaagagacgatgaaaac
tggatgaaacacactttgggatattgggagaatgagaaggtccggttagattacaggcca
gtgcacatgaacacgttggacgatgaggtggaatcattccctcctaaagctcgtgtttac
tga

DBGET integrated database retrieval system