KEGG   Phaseolus vulgaris (common bean): PHAVU_004G064800gHelp
Entry
PHAVU_004G064800g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00630  Glyoxylate and dicarboxylate metabolism
pvu00710  Carbon fixation in photosynthetic organisms
pvu01100  Metabolic pathways
pvu01200  Carbon metabolism
Module
pvu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pvu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pvu_M00532  Photorespiration
pvu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PHAVU_004G064800g
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHAVU_004G064800g
Enzymes [BR:pvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PHAVU_004G064800g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 18632219
NCBI-ProteinID: XP_007151650
UniProt: V7C0J7
LinkDB All DBs
Position
4
AA seq 180 aa AA seqDB search
MASSMISSPAVTTVNRAGAGAGMVAPFTGLKSLGGFPSRKMNNDITSVANNGGRVQCIQV
WPTVGKKKFETLSYLPPLTKEQLAKEVDYLLRKGWVPCLEFELEHGFVYREHNKSPGYYD
GRYWTMWKLPMFGCTDSSQVLKELYEAQTAHPDGFIRIIGFDNVRQVQCISFIAYKPPGY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaatgatctcctcccccgctgtgacgaccgttaaccgtgccggtgccggt
gccggtatggtggctcctttcactgggctgaagtccctgggagggttcccaagcaggaag
atgaacaatgatattacttccgttgcgaacaacggtggaagagtgcaatgcattcaggtg
tggccaacagttgggaagaagaagttcgagactctttcgtacctgccacccctgacaaaa
gaacaattggcaaaggaagtagactaccttcttcggaaaggatgggttccgtgcttggaa
ttcgaattggagcatggtttcgtgtaccgtgaacacaacaagtcacctggatactatgat
ggaaggtactggacgatgtggaagctgcctatgtttgggtgcactgattcttctcaggtg
ttgaaggagctttacgaggctcagactgctcatcccgatggtttcatccgtatcattgga
tttgacaacgttcgtcaagtgcagtgcatcagtttcattgcctacaagccaccaggctac
taa

DBGET integrated database retrieval system