KEGG   Phaseolus vulgaris (common bean): PHAVU_004G122700gHelp
Entry
PHAVU_004G122700g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00040  Pentose and glucuronate interconversions
pvu00051  Fructose and mannose metabolism
pvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PHAVU_004G122700g
   00051 Fructose and mannose metabolism
    PHAVU_004G122700g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     PHAVU_004G122700g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C NCD3G Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 18632823
NCBI-ProteinID: XP_007152352
UniProt: V7C611
LinkDB All DBs
Position
4
AA seq 364 aa AA seqDB search
MGKGGMSIDDHGEDKEENMAAWLLGINNLKIQPFKLPTLGPYDVRVRMKAVGICGSDVHY
LKTLKCAHFIVKEPMVIGHECAGIIEEVGSQVKSFVPGDRVALEPGITCWRCDHCKQGRY
NLCDDMKFFATPPVHGSLANQIVHPANLCFKLPDNVSLEEGAMCEPLSVGIHACRRANIG
PEANVLVMGAGPIGLVTLLAARAFGAPKIVIVDVDDYRLSVAKSLGADDVVKVSTNIQDV
AEDIVQIQKAMGAAINVTFDCAGFDKTMSTALGATQPGGKVCLVGMGHSEMTVPLSPAAA
REVDVIGVFRYMNTWPLCLEFIRSGKIDVKPLITHRFGFSQKEVEEAFETSARGGNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggggggaatgtccattgatgatcatggagaagacaaagaagagaatatggct
gcttggcttcttggtataaacaatctcaagattcaacctttcaagcttcctactttagga
ccctatgatgtcagagttagaatgaaggctgttggtatctgtgggagtgatgttcactac
ctcaagacactgaagtgtgcacactttatagttaaggaaccaatggttattggtcatgag
tgtgctgggatcatagaagaagttggtagtcaggtaaagagttttgtgcctggtgaccgt
gttgcgcttgaacctggaatcacttgctggcgatgcgaccactgtaaacagggtcgatac
aatttgtgtgatgatatgaagttttttgctactccaccagttcatggttccctggctaat
cagatagtgcatcctgcaaacctatgttttaagcttccagacaacgtgagcctagaggag
ggggccatgtgtgaacccttaagtgttggtattcatgcttgtaggagagctaatattgga
ccagaagcaaatgtgttggtcatgggagctggacccataggacttgttacactgcttgca
gctcgcgcttttggagcacccaagattgtcattgtggatgtggatgactatcgtttatct
gttgcaaaatctcttggtgcagatgatgttgttaaagtctcaacaaacattcaggatgtg
gctgaagatattgtgcagatacaaaaggctatgggagctgctataaatgttacctttgat
tgtgctggttttgacaaaaccatgtctacagcactgggtgctactcagcctggtggcaaa
gtttgcctagtgggaatgggacattctgaaatgactgtcccactctcccctgcagcagca
agggaagttgatgtgattggagtttttcgctatatgaacacatggcctctttgtcttgag
tttataaggagtggcaaaatcgatgtaaaaccccttataactcacaggtttgggttctct
caaaaggaagtggaagaagcctttgaaacaagtgctcgtggtggtaatgccatcaaggtc
atgttcaacctttag

DBGET integrated database retrieval system