KEGG   Phaseolus vulgaris (common bean): PHAVU_004G131700gHelp
Entry
PHAVU_004G131700g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PHAVU_004G131700g
Enzymes [BR:pvu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PHAVU_004G131700g
Chromosome and associated proteins [BR:pvu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PHAVU_004G131700g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 18632917
NCBI-ProteinID: XP_007152451
UniProt: V7C587
LinkDB All DBs
Position
4
AA seq 307 aa AA seqDB search
MQYTYIKRNIYLTKKVKRSRFDDDGIFCSCAPSAGSTSVCGRDCHCGMLLSSCSSGCKCG
SSCLNKPFQNRPAKKMKLVKTEKCGSGIVADEDIKLGEFVIEYVGEVIDDKTCEERLWNM
KHRGETNFYLCEINRDMVIDATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDI
QKGEHLTYDYQFVQFGADQDCHCGAASCRRKLGVRPTKPKMSSDAALKLVTYQVYQNGRL
QIGSSRVDHRKCLHNCIGEVIRIKRFEKERFGVIKRFDKYSRKHSIMFEDGRVELYDMSK
EDWELVR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacctatataaaacgcaatatatatctcactaagaaggtcaagagatcccgg
tttgatgacgatggaatattctgttcctgtgctccttcagctggatctactagtgtatgt
ggtagagattgccactgtgggatgcttctgtctagctgttcatcaggctgtaaatgtggg
agctcttgtcttaacaaaccattccagaatcgccctgcgaaaaagatgaaattggttaag
actgagaaatgtggttctggaattgtggcggatgaagatatcaagcttggggagtttgtt
atagaatatgttggagaagttattgatgacaaaacatgtgaggaaaggctttggaacatg
aaacatcgtggggaaacaaacttctacttatgtgaaattaatcgagatatggtgatagat
gcaacatataagggaaacaaatcaagatacatcaaccatagttgctgccccaatactgag
atgcagaaatggataattgatggtgaaacaagaattggcatatttgctactcgggacata
caaaagggcgaacatctgacttacgattaccagtttgttcaatttggtgcagatcaagat
tgccactgtggtgctgcttcgtgtaggcgcaaattgggtgtccgacctaccaagcctaaa
atgtcttcagatgctgcattaaaattagttacataccaggtttatcagaatggacgtttg
caaattggaagttctcgtgttgaccaccgaaaatgcttacataattgcattggtgaagtt
attaggataaaacgctttgaaaaggagaggtttggagtcattaaacgatttgataaatat
tctcgaaaacattcaatcatgtttgaggatggtcgtgttgaactttatgacatgtcaaaa
gaggactgggaacttgtgagatag

DBGET integrated database retrieval system