KEGG   Phaseolus vulgaris (common bean): PHAVU_004G144400gHelp
Entry
PHAVU_004G144400g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00250  Alanine, aspartate and glutamate metabolism
pvu00410  beta-Alanine metabolism
pvu00430  Taurine and hypotaurine metabolism
pvu00650  Butanoate metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
Module
pvu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PHAVU_004G144400g
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHAVU_004G144400g
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHAVU_004G144400g
   00430 Taurine and hypotaurine metabolism
    PHAVU_004G144400g
Enzymes [BR:pvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PHAVU_004G144400g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 18633053
NCBI-ProteinID: XP_007152608
UniProt: V7C356
LinkDB All DBs
Position
4
AA seq 499 aa AA seqDB search
MVITSTATHPDEQAQSIFSTFASRYVREPIPRFKIPEKSIPKDAAYQIINDELMLDGTPR
LNLASFVTTWMEPECDKLIMASLNKNYVDMDEYPVTTELQNRCVNIIANLFHAPINEDET
AVGVGTVGSSEAIMLAGLAFKRKWKTKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVE
LKEVKLSEGYYVMDPVKAVEMVDENTICVAAILGSTMTGEFEDVKLLNELLTEKNKETGW
DTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKDDLP
DELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMENCLENTRVLKEG
IERTGLFNIISKDIGVPLLAFSLKDSSQHSVFEISDQLRKFGWIVPAYTMPPNAQHIAVL
RVVVREDFSCGLAQRLVSDIEKVMTLLDTLPSIFSTKTAHVTAITNEISEKVKKSAMETQ
REIILYWKRLVDGKKLGAC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcacatccactgctacacacccagatgaacaagcacagagcatattttctact
tttgcttccagatatgtgcgtgaacctattcccaggttcaagataccagagaaatcaata
ccaaaggatgctgcttatcagataataaacgatgagttgatgctggatggcacaccaagg
ctcaacttggcttcatttgtgaccacttggatggagcctgagtgtgacaagctcataatg
gcttcacttaacaagaactatgttgacatggatgagtaccctgtcaccactgagctccag
aaccggtgtgttaatataatagcaaatctattccacgctcctataaatgaagatgagact
gcagtaggtgtgggaactgtgggttcatcagaggcaataatgttagcaggtttggctttt
aaaaggaaatggaagaccaagagaaaagcagaaggcaaaccatatgacaagcctaacata
gttactggggctaatgtgcaggtttgttgggaaaaatttgcaaggtactttgaggtagag
cttaaggaagtgaaactcagtgagggatactatgtgatggaccctgtgaaagcagttgaa
atggtggatgagaacaccatctgtgttgcagccattttgggatcaactatgactggagag
tttgaggatgtgaaacttctcaatgaacttctcactgaaaagaacaaggaaacaggttgg
gataccccaattcatgtagatgctgccagtggggggtttattgctccatttctgtatcct
gatctagagtgggattttcgtttgccattggtgaaaagcatcaatgttagtggtcacaag
tacggtcttgtataccctggtgttggttgggttgtctggaggagtaaggatgacttgcca
gatgaacttgtttttcacatcaattatcttggatctgatcagcccactttcacattgaat
ttctctaaaggatccagtcaaattattgcacagtattaccaacttattcggctcggcttt
gagggttataaaaacatcatggaaaattgcttggagaatacaagagttcttaaagaggga
attgagagaacagggctatttaacatcatctccaaggatataggggtgccacttttggcc
ttctctttgaaagacagtagccaacactcggtgtttgagatatcagatcagctgaggaaa
tttggctggatagttccagcctatacaatgccaccaaatgcacaacatattgcagtcctc
agggtggtggttagggaggatttcagctgtggcttggctcagagacttgtttctgacatt
gaaaaagttatgactctcttggacacacttccaagcatcttctctaccaaaactgctcat
gtcacagccatcaccaatgagattagtgagaaggtaaagaagagtgcaatggagactcaa
agagagattattttgtactggaagcgacttgtggatggcaagaaacttggagcatgctaa

DBGET integrated database retrieval system