KEGG   Phaseolus vulgaris (common bean): PHAVU_006G097000gHelp
Entry
PHAVU_006G097000g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PHAVU_006G097000g
Enzymes [BR:pvu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PHAVU_006G097000g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 18628315
NCBI-ProteinID: XP_007147112
UniProt: V5N8E1
LinkDB All DBs
Position
6
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVTGTVYFSQEGNGPTTVTGSLSGLKPGHHGFHVHALGDTTNGCLSTG
PHFNPNGKEHGAPEDESRHAGDLGNVNVGDDGTANFTLTDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggcagttcttggcagcagtgagggtgtcactggaactgtttacttc
agtcaggagggaaatggtccaaccaccgtaactggctctcttagtggtcttaagcctggt
caccatggcttccatgtccatgccttgggggacactaccaatggttgcctgtcaactgga
ccacatttcaatcctaatggcaaggagcatggtgcccctgaggatgagagtcgccatgct
ggtgatctagggaatgtaaatgtcggtgatgatggtaccgccaacttcactcttactgac
agccagattcctcttactggaccaaactccatcattgggagagctgttgttgtccatgct
gatcctgatgatcttgggaaaggtggtcatgagcttagcaagagtactggaaatgctggt
ggcagagtagcctgtggtatcattggtctgcaaggataa

DBGET integrated database retrieval system