KEGG   Phaseolus vulgaris (common bean): PHAVU_006G124200gHelp
Entry
PHAVU_006G124200g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K17680  twinkle protein [EC:3.6.4.12]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pvu03029]
    PHAVU_006G124200g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PHAVU_006G124200g
Mitochondrial biogenesis [BR:pvu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    PHAVU_006G124200g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Toprim_4 Toprim_2 Toprim Toprim_3
Motif
Other DBs
NCBI-GeneID: 18628599
NCBI-ProteinID: XP_007147434
UniProt: V7BQY4
LinkDB All DBs
Position
6
AA seq 369 aa AA seqDB search
MSVFQNQWLRLPLTQSLFSKLLPRTFAAVLSTRPCSVWCHSVARNTTVPSTPGVVDNTFD
APKVKVLKEKMELLGISLENSCLPGQYHNLFCPKCKGGQLKERSLSFHIISNGEFAMWRC
FRAKCGWAGQVFADDKELYSGVCTKAKFSRKIAEESLGLEPLSPKLVAYFKERLISEKTL
SRNSVRQLSDNKAVIAFTYKQNGLLVGCKYRALEKRFWLDKGTEKILYGIDDISQVSEII
IVEGEIDKLSFEEASFRNCVSVPVGAPVKVSSKDLPPIEKDTAFQYLWNCKEYLDKAVRI
ILATDNDPPGQALAEELARRLGRERCWRVVWPKKDEFSSFKDANEVLQHIGADALKKIVE
NAEPYTNAN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtttttcagaaccaatggctgcgtcttcccctcactcaatctctattctccaag
ttgcttcccagaacctttgcagcagtgttatccacaagaccatgttccgtttggtgtcat
tcagtagctcgtaacaccactgtgccctctactccaggtgttgtggacaatacttttgat
gcacctaaagtgaaagtattgaaagagaaaatggaacttctgggcatcagcttggaaaac
tcttgtttgcccgggcagtaccataatctgttttgtccaaaatgcaaaggtgggcaatta
aaggagaggagtttgtcttttcacattatctctaatggtgaatttgcgatgtggaggtgt
tttcgagctaaatgtggttgggctggtcaggttttcgcagatgataaggaattgtacagt
ggggtttgtactaaggccaagttttctagaaaaatagcggaggagagcttaggattggaa
ccacttagtcctaagcttgttgcttactttaaagagagactgatatcagagaaaaccctg
agcagaaattctgtaagacaactgtctgacaataaggcagtcattgcttttacttataaa
caaaatgggttgcttgttggctgcaaatacagagcactggagaaaagattttggctggat
aaaggcacagagaagatactatatggaattgatgacattagtcaagtatccgaaatcatc
attgttgaaggggaaattgataagctttcatttgaggaggctagctttcggaattgtgtt
agtgttccagtgggtgcaccagtaaaggtttcttcaaaagatttgccaccaatagagaag
gacactgcattccaatacctgtggaactgcaaagagtacttggataaggcagttcgcatt
atcctggcaactgataatgatccgccaggtcaagctttagcagaagagctggcacgacgc
cttggccgagaaaggtgttggcgtgtagtctggcctaagaaagatgaattcagctctttc
aaagatgcaaatgaggttctccaacacattggagctgatgctttgaagaaaatagttgag
aatgcagagccatatacaaatgccaactag

DBGET integrated database retrieval system