KEGG   Phaseolus vulgaris (common bean): PHAVU_006G125100gHelp
Entry
PHAVU_006G125100g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00052  Galactose metabolism
pvu00500  Starch and sucrose metabolism
pvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PHAVU_006G125100g
   00500 Starch and sucrose metabolism
    PHAVU_006G125100g
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PHAVU_006G125100g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18628608
NCBI-ProteinID: XP_007147443
UniProt: V7BNA8
LinkDB All DBs
Position
6
AA seq 918 aa AA seqDB search
MCIINPYAIIFHLFKSKTMATPWNTQLTTTIFTISLFLIFCCASSSQPEPVGYGYTLSTV
HSYPITDSLIANLNLIKSSSVFGPDIPHLSLSASFENKDRLRVRITDSNNQRWEIPQLLI
PTPSSSQYHPLRYLNTKQGSPDTLTLTHPDSDLVFTLYNTTPFGFTISRKSSNDLLFDAA
PDPSNPQTFLVFKDQYLQLSSSLPPQRASLYGLGEHTKTSFKLRPNQTLTLWNADIASAT
PDVNLYGSHPFYLDVRSPSPDGRVKAGTTHGVLLLNSNGMDIVYGGDRITYKAIGGVFDL
CFFAGSSPELVLEQYTELIGRPAPMPYWSFGFHQCRYGYKNVSDLQDVVANYAKATIPLE
VMWTDIDYMDAYKDFTFDPINFPLDKMRIFVDTLHKNGQKYVLILDPGISVNETYETYVR
GLKADVYIKRNGSNYLGKVWPGQVYYPDFLNPRSQSFWGGEIKLFRDLLPFDGLWIDMNE
LSNFITSPPIASSNLDNPPYKINNAGNQRPINDRTVPATSLHYGNITEYNVHNLYGLLES
KATNKALVDITGKRPFVLTRSTFVSSGKYAAHWTGDNAATWNDLAYSIPSILNSGIFGIP
MVGADICGFGGNTTEELCRRWIQLGAFYPFARDHSEINSIRQELYIWESVAASARKVLGL
RYRLLPYFYTLMYEAHTKGTPIARPLFFSFPEDVTTYEINSQFLLGKGVLVSPVLQSGAT
TVDAYFPKGTWFDLFNVSNSVNAETGKYVTLDAPPDHINVHVGEGNILALQGEAMTTDAA
RKTAFELVVVISGSGNSYGEVYLDDGDTLDIAGVKHEWTWVSFYGAIRNNSVVITSKVTN
GRFALDQRWIIDKVTFLGIPKHKKFNRMDLSGKELNTVTGISSVTKAVVNSSSEFVTVQV
SKLSYLIGEEFKLEVEIK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgtgcataataaatccatatgctatcatttttcatctcttcaaatctaagaccatggct
acaccatggaacactcaactcacaaccactatctttactatttctctttttctcatcttc
tgctgcgcttcatcgtcacaaccagaaccagttggttatggctacaccctctcaactgtt
cacagttatcctataaccgactctttgattgcaaaccttaacctcatcaaatcttcctct
gttttcggacccgacattccacacctctccctctctgctagctttgagaacaaggatagg
ttgagagtgagaatcactgactccaacaaccaaagatgggaaattccacaacttctaatt
cccacaccctcctcttctcagtatcaccctcttcgctacctcaataccaaacaaggttcc
ccagatactctcactctcacacatccagactcagaccttgtgttcactctctacaacacc
accccatttggcttcactatctcacgcaaatcctccaacgaccttctcttcgatgccgca
ccagacccttccaatcctcaaacttttcttgttttcaaagatcagtacttgcagctctcc
tcctccctcccaccacaaagagcctctctgtacggcctcggggaacacaccaagacctcc
ttcaagctccgaccgaaccagacccttacactgtggaatgcagatattgcaagcgccacc
ccggacgtgaacctttatggctctcaccctttctacttggatgtgagatcaccctcccct
gatggacgagtgaaggctggcaccacacatggggtgttgctgctcaacagcaatggaatg
gacattgtgtatggcggtgatcgcattacttataaggccattggtggggtttttgatctc
tgtttcttcgctggatcctctccagaattggtgttggaacagtacactgaactcattggc
aggcctgctccaatgccttattggtcctttggttttcatcagtgtcgatatggctacaag
aatgtaagtgatctccaggatgtggttgccaactatgcaaaagcaactataccccttgaa
gtaatgtggacagatattgattatatggatgcatataaagattttacatttgaccccatc
aactttccgctggataagatgagaatttttgttgacacccttcacaaaaatggtcagaaa
tacgtgcttatcttggatccaggtatcagtgtaaatgagacatatgaaacctatgttaga
ggtttgaaggctgatgtctacataaagagaaatggaagcaactatcttggtaaagtttgg
cctggacaagtttattaccctgatttcctaaaccctcgcagccaatcattttggggtggg
gaaatcaaattatttagggaccttctgccttttgatggtctctggattgacatgaatgag
ttatctaatttcattacttctccccccattgcgtcttctaatcttgataaccctccctat
aaaattaacaatgctggaaaccaacgacccattaatgacagaacagtcccagcaacatct
ttgcactatggtaatatcactgagtacaatgtccacaatttgtatggactactggaatcc
aaagctactaacaaggcattggtggatataactggtaaaaggccattcgtattaactaga
tcaacttttgtaagttctggtaagtatgctgctcattggacaggagataatgctgctaca
tggaacgatttggcatattcaattccatccatattaaattctggaatctttgggattcca
atggttggagcagatatatgtggttttggtggaaatacaactgaagaactttgtcggcgt
tggatccagttaggggctttttacccctttgccagagatcattcagaaataaactccatc
agacaagagctttacatttgggaatcagttgcagcatcagctaggaaagtgcttggactt
cgttaccgtcttctcccttatttctacacgctaatgtatgaagcccatacaaaaggaaca
cccattgcacgaccccttttcttttcattccccgaggatgtcacaacatatgaaataaac
tctcagtttctattaggcaaaggggttctggtatcacctgtactacaatctggggcaacc
actgttgatgcatactttcctaaaggaacctggtttgacctcttcaacgtctcaaattca
gtgaatgcagaaacaggcaagtatgtgactcttgatgctccacctgatcacataaatgtg
catgtaggggaaggtaatattttggccttgcaaggagaagcaatgacaactgatgctgcc
cggaaaactgcatttgaacttgttgtagttatcagtggcagtggaaatagttatggtgaa
gtgtatttggatgatggggatacactagacatagcaggggtgaaacatgagtggacatgg
gtaagcttttatggggctatacgcaacaatagcgttgttattacatctaaggtgactaat
ggaagatttgctctggaccagaggtggatcatagacaaggtaactttcttggggatacct
aagcacaagaaatttaatagaatggatttgtcagggaaagagttgaatactgtgactgga
ataagttcagtgactaaagcagttgtgaatagctcctctgagttcgttactgtacaagtt
tctaaattgtcatatcttattggagaggaattcaagttggaggtagaaatcaagtag

DBGET integrated database retrieval system