KEGG   Phaseolus vulgaris (common bean): PHAVU_006G141900gHelp
Entry
PHAVU_006G141900g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00240  Pyrimidine metabolism
pvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PHAVU_006G141900g
Enzymes [BR:pvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PHAVU_006G141900g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 AAA_30 cobW AAA_24 AAA_22 MobB YyzF
Motif
Other DBs
NCBI-GeneID: 18628779
NCBI-ProteinID: XP_007147640
UniProt: V7BNS9
LinkDB All DBs
Position
6
AA seq 279 aa AA seqDB search
MKSLLNPKFSALSSKASPFPLFSLPSQSTARLTFRNNPRRIPNRLLRLNPSPFSSNKFTC
TNQNRSLQTEPSPPSSGEIHVIVGPMFAGKTTSLLRRIQLETANGRNVAVIKSSKDTRYG
LDSIVTHDGAKLPCWALTNLSSFKQKFGIDAYEKLDVIGVDEAQFFDDLYEFCRQAADDD
GKTVIVSGLDGNYMRRSFGSVIDIIPLADSVTKLTATCEICKKPASFTLRKTQDKQIELI
GGVDVYMPVCRQHYVSGQVAMEAARHVLESHKVECGSCT
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcccttctcaacccaaagttttcagctttatcttccaaagcctctccttttcct
ctgttttcactaccttctcaatccacagctcgattaactttccgcaacaacccacgtcga
attcccaatcgtcttctccgcctcaacccatcacccttttcgtccaataagttcacttgc
accaatcaaaatcgaagcttgcaaacggagccctcgccaccttcctccggtgagatccac
gtcatagtggggcccatgttcgctggaaaaaccacctcgctccttcgtcggattcaattg
gaaaccgccaacggcagaaatgtagctgtaattaaatctagcaaggatacaagatatgga
ttagattcaattgttacacatgatggtgcaaaattaccatgttgggcactgacaaactta
tcatcattcaagcagaagtttggaattgatgcttatgagaagctggatgtgattggtgtt
gatgaagcgcaattctttgatgacctttatgaattctgccgtcaagctgctgatgatgat
ggaaaaacagtaatagtttcaggattagatgggaactacatgaggaggagctttggttct
gttattgatataattccccttgctgattctgtaaccaagttaactgctacctgtgagata
tgtaaaaaacctgcttcgtttaccctgaggaagacacaggataagcagattgaattgatt
ggtggagttgatgtctacatgccagtgtgtcggcagcactatgtcagtggacaagtagcc
atggaagctgcaagacatgtccttgaatcccacaaggttgaatgcggctcctgtacataa

DBGET integrated database retrieval system