Phaseolus vulgaris (common bean): PHAVU_006G217600g Help Entry PHAVU_006G217600g CDS       T03093                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism pvu  Phaseolus vulgaris (common bean) Pathway pvu03060   Protein export pvu04141   Protein processing in endoplasmic reticulum pvu04145   Phagosome Brite KEGG Orthology (KO) [BR:pvu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PHAVU_006G217600g    04141 Protein processing in endoplasmic reticulum     PHAVU_006G217600g  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PHAVU_006G217600g  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pvu04131]     PHAVU_006G217600g   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pvu02044]     PHAVU_006G217600g Membrane trafficking [BR:pvu04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     PHAVU_006G217600g Secretion system [BR:pvu02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    PHAVU_006G217600g BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  18629551 NCBI-ProteinID:  XP_007148544 UniProt:  V7BU33 LinkDB All DBs Position 6:31709612..31711113 Genome browser AA seq 69 aa AA seqDB search MDAIDSVFDPLREFSKDSVRLVKRCHKPDRKEFSKVAVRTAIGFVVMGFVGFFVKLIFIP INNIIVGSG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacgccattgattccgtcttcgatcccctcagagaattctccaaggacagtgtcaga ctcgtcaagcgatgccacaaacccgatcgtaaagaattctctaaggttgctgtgcgtacc gcgattggtttcgttgtgatgggattcgtcggtttttttgtcaagctcatcttcattcca atcaacaacatcatcgtcggatctggttag

DBGET integrated database retrieval system