KEGG   Phaseolus vulgaris (common bean): PHAVU_007G090300gHelp
Entry
PHAVU_007G090300g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu00010  Glycolysis / Gluconeogenesis
pvu00020  Citrate cycle (TCA cycle)
pvu00620  Pyruvate metabolism
pvu01100  Metabolic pathways
pvu01110  Biosynthesis of secondary metabolites
pvu01200  Carbon metabolism
Module
pvu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHAVU_007G090300g
   00020 Citrate cycle (TCA cycle)
    PHAVU_007G090300g
   00620 Pyruvate metabolism
    PHAVU_007G090300g
Enzymes [BR:pvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PHAVU_007G090300g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 18625332
NCBI-ProteinID: XP_007143656
UniProt: V7BDN1
LinkDB All DBs
Position
7
AA seq 460 aa AA seqDB search
MAHLLHTPFIPSSSSLRRAAVTHRKTTSPLVVRAKIREIFMPALSSTMTEGKIVSWTKSE
GDKLSKGDSVVVVESDKADMDVETFYDGYLAAIVVEEGGVAAVGSPIAFLAETEDEIAQA
KSKASSSSSAPAPAAAAAPAPPVESQPEKVAAPVAAAVPAPVVVSSHPASEGGKRIVASP
YAKKLAKELKVELGRVVGTGPMGRIVAKDVEAFAASGNVAAAASPAPGKSAAPAGVELGS
VVPFTTMQGAVSRNMVESLAVPTFRVGYTITTDALDALYKKIKSKGVTMTALLAKATALA
LAKHPVINSSCRDGNSFTYNSNINVAVAVAIDGGLITPVLQNADKIDVYSLSRKWKELVD
KARAKQLQPHEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPAVVATKDGRIG
MKNQMQVNVTADHRVIYGADLASFLQTLSLIIEDPKDLTF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccttcttcacactcccttcatcccctcttcctcctcgctccgccgcgccgcc
gttacccaccgcaaaacgacgtctcccctggtcgttcgggctaagatccgggagattttc
atgccggcactcagctccactatgacggagggcaaaatcgtctcctggaccaaatccgag
ggcgataagctctccaagggcgacagcgtcgttgtcgttgagtctgacaaggccgacatg
gacgtcgagacattctacgacggctacctcgccgccatcgtcgtcgaggaaggtggtgtc
gctgccgtcggatcccccatcgcattcctcgctgagaccgaggatgagattgctcaagcc
aagtccaaagcctcctcttcctcttccgcgcccgcgcctgcagctgcagctgcaccagca
ccgcccgttgagtctcaaccggagaaggttgcggcccccgtcgcagctgcggttccggct
ccggtcgtagtgtccagtcatcccgcttcggagggagggaagaggattgttgcgtcacct
tatgcgaagaagctcgccaaggaattgaaggtggagttggggagggtagtgggaactgga
ccaatggggaggattgttgctaaagatgttgaggcatttgcagcttctggaaatgttgca
gcagctgcatcaccagcaccaggcaagagtgcagcacctgcaggggtggagttgggatct
gtggtgcctttcaccacaatgcagggtgctgtgagtagaaacatggtggagagtttggca
gttcccacgttcagggttggttacaccatcaccacagatgcacttgatgccttgtacaag
aagataaagtcaaagggagttactatgaccgcattgcttgccaaggctactgcgcttgca
ctggccaaacaccctgttatcaactcaagttgtagagatggtaatagctttacatataat
agcaacatcaatgttgcagttgctgtggctatagatggcggattgattacaccagtgctt
cagaatgctgataagattgatgtatattcattgtcaagaaagtggaaggagttggtcgat
aaggccagggccaagcagcttcaacctcatgaatacaacactggtactttcactctttcc
aatctgggaatgtttggtgttgatcgctttgatgctattctgccacctggaactggagca
ataatggctgttggagcatcacagccagctgttgtggctaccaaggatggtcgcattggc
atgaagaaccaaatgcaggtcaatgttacagccgatcatcgagtcatctatggtgctgat
ttggcttcgttcttgcaaacactttcactgattattgaggatcccaaagatcttactttc
tag

DBGET integrated database retrieval system