KEGG   Phaseolus vulgaris (common bean): PHAVU_008G009200gHelp
Entry
PHAVU_008G009200g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
pvu03030  DNA replication
pvu03410  Base excision repair
pvu03420  Nucleotide excision repair
pvu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pvu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PHAVU_008G009200g
   03410 Base excision repair
    PHAVU_008G009200g
   03420 Nucleotide excision repair
    PHAVU_008G009200g
   03430 Mismatch repair
    PHAVU_008G009200g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pvu03032]
    PHAVU_008G009200g
   03400 DNA repair and recombination proteins [BR:pvu03400]
    PHAVU_008G009200g
Enzymes [BR:pvu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PHAVU_008G009200g
    6.5.1.6  DNA ligase (ATP or NAD+)
     PHAVU_008G009200g
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PHAVU_008G009200g
DNA replication proteins [BR:pvu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PHAVU_008G009200g
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PHAVU_008G009200g
DNA repair and recombination proteins [BR:pvu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PHAVU_008G009200g
   NER (nucleotide excision repair)
    Other NER factors
     PHAVU_008G009200g
   MMR (mismatch excision repair)
    Other MMR factors
     PHAVU_008G009200g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 18621477
NCBI-ProteinID: XP_007139195
UniProt: V7B061
LinkDB All DBs
Position
8
AA seq 1398 aa AA seqDB search
MDSETLDSTQLYLTALTTLQQPPPPPSAALPPLPSSVPHSKLIPHTRFLVDAFRHAGPHS
HSYFLSHFHSDHYTGLSASWSRGVIYCSATTASLLRHILHVPAALVVPLPLRQPLLIDGV
QVSLLDANHCPGAVQFLFALPCADGTAALRYVHTGDFRFSPSMVSEPALASFVGADAVFL
DTTYCNPKFVFPSQDESIDYVASVVERIERECGDSNDKVLFLVATYVIGKEKILLELARR
FKRKIHVDAKKMEVLRVLGYGESGEFTENGLESNIHVVGWNVLGETWPYFRPNFVKMKEV
MAERGGSYSRVVGFVPTGWTYEVKRGRFAVKSKDSFQIHLVPYSEHSNYDELREYVKFLK
PKRVVPTVGLDVEKSDSKHADRIRKHFAGLVDETANKHEFLRGFCRAPGEEGFKAEKGVS
DALEPSQGMDKEKVIPLEEIEGNKSVGLPSFMGDTCTQDPTLLNDEEKEKIIRELSFCLP
KWVTRVQMLDMISISGSNVVELVSNFYERETEFHEQVISCQTPVSTSKCCTINDTDSLVK
PSLNNTNRTCENIDIFPSQDSKSTILGRKVSSPISPAKSPAKRKRSNDSKLNKKGKVKAK
SEPSGSKQSTLTRFFSKVTPEMPGGTQSDNSEPKLDQSSEVVDLLPTDVGQIYKDEIDQF
LQIINGNESLKNHAMTIIKKTKGDVNKALDIYYCNSGNLSENENELSVIEESTIDRPLVT
KHASEGLRVTPDMSGQKVLKDNVDATQLSLPPEKYSPKEHACWTDGQPAPYLHIARTFNL
LEGERGKIKATSLLCNMFRSLLALSPADVLPAVYLCTNKIAADHENKELNIGGSLVTAAL
EEACGTNRLKIREMYNKFGDLGDVAQEFRQTQRLLAPPTPLLIKDVFSALQKISVQTGSG
STSRKKGIIVHLMHSCREKEMKFLVRTLVRNLRIGAMLRTVLPALAHAVAMNSSPTFHQG
GTAENLKEKLQVLSMAVVEAYNILPNLDLIVPSLMNKGIDFSVSSLSMVPGIPIKPMLAK
ITNGIPQALKLFENKAFTCEYKYDGQRAQIHKLVDGSIRVFSRNGDETTSRFPDLIDIIK
ESSKPVASTFIMDVEVVGIDRKNGCRIMSFQELSSRGRGGKDALVTAESIKVAICIFVFD
IMFANGEQLLGFPLRLRRKYLKDLFYAEKPGYFEYAKETTIEADDACLACEATLTKINAF
LEDALRSSCEGIMVKTLDVEAGYFPSKRSDKWLKVKRDYVDGLNDTLDLVPIGAWHGNGR
KAGWYSPFLVACFNPETEEYQSVCRVMSGFSDSFYIEMKEFFSGDKVLSKKPPYYQTGEV
PDIWFCPQVVWEIKGADFTVSPVHHAAIGLVHPSRGISIRFPRFICCVSDRNPEDCSTAS
DIVEMFHSQTRKMDVTAK
NT seq 4197 nt NT seq  +upstreamnt  +downstreamnt
atggattctgaaaccctagactccactcagctatacctcaccgccctaacaaccctccaa
caaccccctcctccaccctccgccgccctccccccactcccctcctccgtccctcactcc
aaactcatcccccacacccgcttcctcgtcgatgccttccgccacgccggcccccactcc
cactcctacttcctctcccacttccactccgaccactacaccggcctctccgcctcctgg
tcccgcggcgtcatctactgctccgccaccaccgcctctctcctccgccacatcctccac
gtccccgccgccctcgttgtccccctccccctccgccaaccgctcctcattgacggcgta
caagtctccctcctcgacgccaaccactgccccggcgccgtccagttcctcttcgccctc
ccctgcgccgatggcaccgccgccctaaggtacgtccacaccggcgacttccgcttttca
ccttccatggtttccgagcccgccctcgcctccttcgtcggtgccgatgcggtgtttctc
gacaccacgtattgtaaccctaagttcgttttcccctcgcaagatgaatccattgattac
gttgccagtgttgtggagaggattgaacgtgagtgtggtgatagtaatgataaggttctg
tttcttgttgctacttatgttattgggaaggaaaagattttgcttgagcttgcacgtagg
tttaagaggaagatacatgttgatgctaagaagatggaggttttgagggttcttgggtat
ggtgagagcggtgagtttactgagaatgggttagagagtaatattcatgtagttgggtgg
aatgtgttgggggagacttggccatactttaggcctaattttgtcaagatgaaggaggtt
atggctgagagagggggttcctactccagggttgtgggctttgttccaaccgggtggacc
tatgaggtgaagcgaggtaggtttgcagtgaagtccaaggattcatttcagattcatctt
gtgccctatagtgagcactcgaactatgatgagctgagggagtatgtgaagtttttgaag
ccaaagcgagttgttccgactgtgggtttggatgttgagaagagtgacagcaaacatgct
gacagaattaggaagcattttgccgggttggtcgatgagactgctaacaagcacgagttt
ttaaggggtttttgccgtgcacctggtgaagagggtttcaaggctgagaagggtgttagt
gatgctctggaaccaagtcaaggcatggacaaagaaaaggtcattccattggaggagata
gaaggtaataaaagtgtgggtttgccttcttttatgggagatacttgtacacaagatcct
actttgctgaatgatgaagaaaaagagaaaataattcgagaacttagtttttgtttgccc
aagtgggtcacccgagtccagatgctggatatgatcagcatctcagggagcaacgttgtt
gaacttgtttctaatttctatgaacgtgaaactgagtttcatgagcaagtgatttcctgt
caaactcctgtttcaacatccaagtgctgcacaataaatgacactgattcacttgtaaaa
cctagccttaataatacaaacaggacatgcgaaaatattgacatttttccgagtcaagac
tccaaatcaactatcctggggcggaaagtatccagtcccatatctcctgccaaaagtcct
gccaaaaggaagagaagtaatgacagtaagctaaacaaaaaaggcaaagtcaaagcaaaa
tctgaaccaagtggttcgaagcagtccacacttacaagattcttcagtaaagtaacacct
gagatgcctggtggtactcaatctgataattctgaaccaaagcttgaccaaagctctgaa
gttgtggacttgttgccgactgatgttggacaaatatacaaggatgaaattgatcaattt
ttgcagataataaatgggaatgagtcattaaagaatcatgccatgactataattaagaag
acaaaaggagatgtcaataaagcactggatatatattactgtaattctggaaatcttagc
gaaaatgaaaatgaattatcagttatagaggagagcacaattgatagacctttagtaacg
aagcatgcgtcagagggattgagagttacgcctgatatgtctgggcagaaagtgttaaaa
gataatgtagatgccactcaactatctctaccaccagagaaatacagccctaaagaacat
gcatgttggacagatggacagcctgcaccatatttacatattgcacgaaccttcaacctg
ctcgagggtgagagaggaaagattaaagctacttcattgttatgcaatatgttcagaagt
ctgttggccttatctccagcagatgtgcttcctgcagtgtatctatgcacaaacaaaatt
gctgcagaccatgaaaataaggaactaaatattggtggaagtttagtcactgcagcactt
gaagaggcatgtggaacaaatcgtttgaaaataagggagatgtacaacaaatttggtgat
cttggtgatgttgctcaagaatttcgtcaaacacagagattgcttgcaccacctacacca
cttctaattaaggatgttttctctgcgctacaaaagataagtgtacaaacaggcagtgga
agtacatctcggaagaaaggcattattgttcatctcatgcactcctgccgtgagaaggag
atgaagtttcttgttcgtaccttggtcaggaacctaaggattggggccatgcttagaact
gttttgcctgcattggctcatgctgttgctatgaattctagccccacttttcaccaagga
ggaactgcagaaaatttgaaggagaaacttcaggttctttctatggcagttgttgaagca
tataacatactgcctaatctggatctcatagttccatctctcatgaacaaaggcattgat
ttttccgtttcaagtttatcaatggttccaggaatccctattaagcctatgctagcaaag
atcaccaatggtattcctcaagcactgaagctatttgaaaataaagcatttacatgtgaa
tataagtatgatggtcaacgggctcaaattcacaaattagttgatggatccattcgtgtt
ttttcaagaaatggggacgaaacaacttcaagatttcctgatctgattgacataatcaag
gaatccagcaagcctgttgcatcaactttcataatggatgtggaagttgttggtattgac
aggaaaaatggatgtaggattatgtctttccaggagctatcatcacgtgggagaggtggc
aaagatgcattagtgactgcagagagcattaaggtggctatatgcatctttgtctttgat
atcatgtttgcaaatggagagcagttattgggttttcctctacgccttagacgaaagtat
ctgaaggatttattctatgctgagaaacctgggtattttgaatatgcaaaggaaacaact
attgaagcagatgatgcttgcttagcctgtgaagccacattaactaagataaatgctttc
ctggaagatgcactccgctcttcatgtgaaggaattatggtgaaaacattggatgttgag
gctggctattttccatcaaagcgttctgacaaatggttaaaagtcaagcgagattatgtg
gatggattaaatgatacccttgatttagtaccgattggtgcttggcatggaaatggaagg
aaagctggatggtatagtccatttcttgtggcgtgtttcaatcctgaaacagaggagtac
caaagtgtatgtcgagtgatgtctggattctcagattcattttatatagagatgaaagaa
ttcttctctggggacaaagtcttgtccaaaaaaccgccatattatcaaacaggagaggta
ccagacatttggttttgtccacaagtcgtttgggaaataaaaggagcagactttacagta
tccccagttcatcatgctgcaattggtttagttcatccatctcgtggcatttcaatcaga
tttccgagatttatttgctgtgtctcagacagaaacccagaagattgtagcacagcttcc
gatatagttgaaatgtttcattctcagactcggaagatggatgtcacggctaaatag

DBGET integrated database retrieval system