KEGG   Plasmodium vivax: PVX_003835Help
Entry
PVX_003835        CDS       T01073                                 

Definition
(RefSeq) serine-repeat antigen 1 (SERA)
Organism
pvx  Plasmodium vivax
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1
Motif
Other DBs
NCBI-GeneID: 5472258
NCBI-ProteinID: XP_001613006
UniProt: A5KBM9
LinkDB All DBs
Position
4
AA seq 1086 aa AA seqDB search
MISKMFFDWVCTEGVVKCEQEGGGSGTSDSSGGDPQTSPKGGEAASSAHGSQGSKESVTP
GGSHAQQEAAAPEKTLVPQESPAKEGGAPPSVPENQAHSPQTPGGPPPTASNIIGTGVSN
NGSPPHAAATPGGDNPKQEEATTALKPIQVKSALLKDHKGVKVTGPCDATFQVYLVPYLY
IDVNAKNTEIEMDPMFTKVDNKIKFEEGKHRLMNICEKGKTFKLVVYMYEDVLTIKWKVY
APKGVPAADKTLDVRKYKMRDIGRPITSIQVLATSKNDETVLVESKNYSVMEEIPEKCDA
IANECFLSGVLDVQKCYHCTLLLEKKENAQECFKFISPEIRDRFDDIKTKGEDEEDPNEA
ELEESIHTILEKMYQNGGANNEVNHLAILDDTLKEEIQNYCAMMKEMDTTGVLENYEMGN
ADDVFGNIAKMMGKNGNYSVSSLPNKMKNAAICLKSPDDWVEGKTGLMLPNLVPPYLVHN
NVEDVTTSLETSSDGTTAFKQDDDGTIDLTNLDCVDVHPSVLADKMHCNDDYCDRAKDTS
SCMAKIEVEDQGDCATSWLFASKMHLETIKCMKGYDHVASSALYVANCSDKEESDKCQAA
SNPLEFLDILEETKFLPAESDLPYSYKQMGNACPEPKSYWQNLWADVKLLEKQYEPNAVS
TKGYTAYQSDHFMANMDAFIKMVKSEVMKKGSAIAYVKAAGVMTHDMNGVDVHSLCGGET
PDLAVNIVGYGNYISPEGVKKSYWLMRNSWGKYWGDDGTFKVDMHGPPGCQHNFIHTAAV
FNLDMPLATHSINKDPEISDYYLKNSSDYYENLYYKKFQGSGATGGAGKQWVQGASTVYG
QEGDPKVADEAGGEAAQSITTHSRAEPAGDAPPSGPPHAGTDSEQGEGTGPTDGEGPTRV
VDEKAQAGGPLTSPGTLQDAVAPGGPQGPPEQGSPGSPGPQETPGPQGPPVQQGSPGPQL
PPVQPTAPVPPVLPVPPVLPVPPAAPLPGAPTNSTVPTTESEVKEVLHILKHIKKGKVKV
GLVTYDTEKVIGAEKVCSRAYAVDHEKQEECVEFCEANWDACKGKVSPGYCLTKKRGSND
CFFCFV
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaaaaatgtttttcgattgggtctgcaccgaaggtgtggtcaaatgtgaacag
gagggaggcggatcgggcacaagcgattcctcaggtggggatccccaaacgagtccaaag
ggaggtgaggctgcctcatctgctcacggttcacaaggatcaaaggaaagtgtcacacca
ggtggaagccatgctcaacaggaagcagcagctccagagaaaacactagttccacaggaa
tcaccagctaaagagggtggtgcaccccccagtgttccagaaaaccaagcacatagccct
caaacaccgggaggaccccctccaactgcatccaacatcatcggtacaggcgttagcaat
aatggaagtcccccacatgcagccgccacacccgggggtgataaccccaaacaggaggaa
gccacaactgctttgaagcccattcaagtaaagtcagctctgctgaaggaccacaaagga
gtgaaggtcaccgggccgtgtgacgccaccttccaggtttacctcgtgccctatttgtac
atcgacgtgaatgccaaaaatacagaaatagagatggaccccatgttcaccaaagtggat
aataagatcaaatttgaagaaggaaagcaccgcctgatgaacatttgcgagaagggaaaa
accttcaagctagtggtgtacatgtacgaggacgttttgaccataaaatggaaggtgtac
gctcccaaaggggtgccagcagcggacaagacgctggacgtgcgaaagtacaaaatgagg
gacatcggcaggccgatcacctccatacaagtgttggccacgtccaaaaacgacgaaact
gttctggtcgaaagtaaaaattactctgtgatggaggagataccggagaagtgtgacgcg
attgccaacgagtgcttcctgagcggcgtgctggatgtgcagaagtgctaccactgcact
ttgctcctggagaagaaggaaaatgcgcaggaatgcttcaagttcatttcgcccgagata
agggaccgcttcgatgatatcaagaccaagggagaggacgaggaagacccaaacgaagca
gaactggaagagtctattcataccattttggaaaaaatgtaccaaaatggaggagcaaat
aatgaggttaaccatttggccatcttggatgacacccttaaggaggagatacaaaattat
tgtgccatgatgaaggagatggacaccactggggtgctcgaaaactacgaaatggggaac
gcagatgatgtgtttggaaatatagcaaagatgatggggaaaaatggaaattatagcgtc
tcttcgttgccaaataagatgaagaatgcggccatttgtttgaaaagccctgacgactgg
gtggaaggcaaaacggggctgatgctccccaacttggtgcctccctatttggtccacaac
aacgtagaggatgtcaccacctcattagagacatcctcagatggaacgactgccttcaag
caagacgatgatggtactatcgatttgaccaacctggactgcgtagatgtgcaccccagt
gtgctcgcggataagatgcactgcaatgatgactactgcgatagggcgaaggataccagc
agttgcatggccaaaattgaggtggaggaccagggcgactgcgccacctcttggctcttc
gcctcgaagatgcacctcgaaacgatcaagtgcatgaagggttacgatcacgtcgctagt
tctgccctctacgtggctaactgctccgataaggaagagagcgacaagtgtcaagcggcg
tcaaacccgctcgaatttttggacatcctggaggagaccaaatttttaccagccgagtcg
gacctaccatactcttacaagcaaatgggaaacgcctgtccggagccgaagagttactgg
caaaatctttgggctgacgtgaagctcctagaaaagcagtatgaacccaacgcggttagc
accaaggggtacacggcctaccagagcgaccacttcatggccaacatggacgcgtttatt
aagatggtaaaatctgaggtgatgaaaaagggatccgcaatagcctacgtgaaagcggca
ggagtgatgacccacgacatgaacggcgtggatgtgcacagcttgtgtggcggtgaaacg
ccagacctcgcagttaacatagtgggttatggcaactacatctccccggagggggtgaag
aagtcctactggctgatgcgaaacagttggggcaaatactggggggatgacggcaccttc
aaggtggacatgcatggaccgcctggatgccaacacaacttcatccacaccgccgccgtc
ttcaacctggacatgcccctcgccacgcactccatcaacaaggacccagaaataagcgac
tactatttgaagaattcgtctgattactatgagaatctgtattacaagaagttccaggga
agtggcgccacggggggagccggtaagcagtgggtgcagggagcctccactgtgtatggg
caagagggtgatccaaaagtggctgatgaagcgggaggagaagcagcacagagcataact
acccattcaagagctgaacccgcaggagatgcacccccttcaggaccacctcatgcagga
acggactcagaacagggagaaggaacaggacctacggatggagaaggaccaacgcgggtt
gtagatgaaaaagcacaagcgggaggaccactcacaagcccaggaactttgcaagatgca
gtcgcaccaggtggaccacaaggaccaccagaacaaggatcaccaggatcaccaggacca
caagaaacaccaggaccacaaggaccaccagtacaacaaggatcaccaggaccacaacta
ccacccgtacaacccacagcgcctgtaccacccgtattaccggtaccacccgtattaccg
gtaccacccgcagcgcccctacctggcgccccgaccaacagcaccgtacccaccaccgag
tcggaggtgaaagaagttcttcacatcctgaagcacatcaaaaagggcaaagtaaaagtg
gggctagtcacgtacgacacggagaaggtgattggcgcggagaaggtttgctccagagcg
tatgccgtggaccatgagaagcaagaagagtgcgttgagttttgcgaagcgaactgggac
gcatgcaagggtaaagtgtctcccgggtactgcttgacgaagaagagaggaagcaacgac
tgcttcttctgctttgtgtga

DBGET integrated database retrieval system