KEGG   Plasmodium vivax: PVX_083195Help
Entry
PVX_083195        CDS       T01073                                 

Definition
(RefSeq) hypothetical protein
Organism
pvx  Plasmodium vivax
SSDB OrthologParalogGFIT
Motif
Pfam: Spindle_Spc25 DUF745 MCPsignal Spc7 Reo_sigmaC MAD Exonuc_VII_L DUF4863 Effector_1 LEF-9 DUF5339 Atg14 ALMT Band_3_cyto dCache_3 DUF16 Sec8_exocyst TMPIT Mnd1
Motif
Other DBs
NCBI-GeneID: 5473523
NCBI-ProteinID: XP_001614238
UniProt: A5K897
LinkDB All DBs
Position
12
AA seq 216 aa AA seqDB search
MEEVINNNEVKRALQQQLNQMVEENEKQYNDLIAYIENEKKQIEIMKNKTREKKSSINRI
THEIEANTVLVTELKESVMEEEKKLDEYPKLIEEINEQLNLILKNFDSSKLEYNTVKLHK
DYIQNEWKRKLSTLYNLLGFEIILQDDKIAIEFSNIQPGDPQKKYRATVALHNGTYEAIE
TAPRLNKFDDYVNGLNKGLPFTTFCCLLRKSFKELK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtgattaacaacaacgaggtaaagcgggcgctgcagcagcagctgaatcag
atggtggaagaaaacgaaaagcagtacaacgacttaatagcgtacatcgaaaatgagaaa
aaacaaattgaaatcatgaaaaacaaaacgagggagaagaaaagctcaataaacaggata
acccacgaaatcgaagccaataccgtcctagtcacagagctgaaggagagcgtgatggaa
gaggagaaaaagctggacgaataccccaagctgattgaagaaattaacgagcaactgaat
ttaattttaaaaaatttcgactcctccaagttggagtacaacacagtcaagctgcacaag
gactacatccaaaacgagtggaaaagaaaactgagcaccctctacaatctgctcggattt
gaaatcatattgcaagatgacaaaatagcaatcgagttttcgaatattcagccaggcgat
cctcagaagaaatatcgagccaccgtcgctttgcacaacgggacctacgaagccatcgaa
accgcgccccggctaaacaaatttgacgattacgtaaacggcctaaataagggactcccc
ttcaccaccttctgctgcttactcagaaagtcattcaaagagttaaaatag

DBGET integrated database retrieval system