KEGG   Plasmodium vivax: PVX_111005Help
Entry
PVX_111005        CDS       T01073                                 

Definition
(RefSeq) flavoprotein subunit of succinate dehydrogenase, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pvx  Plasmodium vivax
Pathway
pvx00020  Citrate cycle (TCA cycle)
pvx00190  Oxidative phosphorylation
pvx01100  Metabolic pathways
pvx01110  Biosynthesis of secondary metabolites
pvx01130  Biosynthesis of antibiotics
pvx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PVX_111005
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PVX_111005
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PVX_111005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO Lycopene_cycl FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 5471444
NCBI-ProteinID: XP_001608426
UniProt: A5KDV6
LinkDB All DBs
Position
6
AA seq 633 aa AA seqDB search
MLTVRRKCSPAFALSTRLNFSSVKKKAYDIVDHHYDAVIVGAGGAGLRSGLELSKNNYKV
ACISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQNAIQYMCREAP
ESVLELEEFGLPFSRTKSGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAMLHTLYGQ
SLAYNCVFFVEYFVLDLLMASQNECIGVICLNIADGKIHRFFAPHTVIATGGYGRAYLSC
TSAHACTGDGNAIVSRSKLPLQDLEFVQFHPTGIYPAGCLITEGCRGEGGILRNREGEAF
MMRYAPKAKDLASRDVVSRAMTIEINEGRGCGPNADHIYLDLTHLPYETLKERLPGIMET
AKIFAGVNVTNQYIPVLPTVHYNMGGIPTNYKTQVLTQRVNSSKGVSTLEGEDIIVKGLY
AAGEAASASVHGANRLGANSLLDIVVFGKRASLTIMEIDKPNIPPISAQADIGDETIQRL
DKIRYNKGTISTAQIRKKMQVCMQKHAAVFRIGPLLEEGYKQILTICSQFNDVYVKDKTL
TWNTDLIETLELENLLTLASQTILAAIERKESRGAHARDDFPERDDKAFLKHSLTWMTDR
DVEKAKFFTTYRGVITKPLDDEMEHVPPVKRVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgttcgccgcaagtgctcccccgcctttgccctttcgacccgcctcaacttt
tccagcgtgaaaaaaaaagcctacgatattgtggaccaccactacgatgcggtgatagtg
ggcgcaggaggagcggggctccgctctggattggagttatccaaaaataattacaaagtg
gcatgcataagtaagttattcccaacaaggtcacacactgtggcagcacaagggggtata
aacgccgcgttaggcaacatgactgaagatgactggaggtggcatgcatacgacacgatc
aaagggtccgactggctaggggaccaaaatgcaattcaatacatgtgtcgagaggcacct
gaatccgttttggagctagaagaatttgggttacccttttctagaacaaaatcaggaaaa
atctaccaaagggcatttggagggcaaagcttaaaatatgggaagggaggacaagcatac
agatgtgcagctgccgcggatagaacgggacatgcaatgcttcatacattgtatggccaa
tcattagcatacaactgcgttttcttcgttgagtattttgttcttgatttgttaatggct
agtcagaacgaatgcattggggttatttgcttaaatatagctgatgggaagattcacaga
ttttttgcaccccatacggtaattgctactggggggtatgggagagcttacttgtcttgc
acgtcagcacatgcgtgcacaggagatggaaatgcaatcgtttcgaggagcaagctaccc
ttgcaggatcttgaatttgtgcaattccaccccacagggatatatccagctggatgttta
attactgaagggtgtagaggggagggaggcatactgaggaacagggaaggagaagcattc
atgatgaggtacgccccgaaagcgaaagatttggctagtcgagatgtagtcagtcgagcc
atgactatagaaataaatgaaggcagagggtgtggccctaatgcagatcatatctaccta
gatttgacacatctgccgtacgaaacgttaaaggaaagactgccaggcataatggagaca
gccaaaatatttgcaggagtgaacgtcaccaatcagtatattcctgtgctcccaacggtg
cactacaacatggggggcataccaaccaattataaaacgcaggtgctaacacagagggtt
aattcgtccaaaggggtgagcacgttggaaggggaagacatcattgttaaagggctatac
gcagcaggagaagcggcttctgcatccgtccatggggccaaccgattgggagctaactcc
ctcctagatattgtcgtcttcggaaaaagggcctccctaaccatcatggaaattgataag
ccaaatatcccccccatcagtgcgcaggcagatataggcgacgaaactatacagcggcta
gacaaaataaggtacaacaaaggaaccatttccacagcacaaatacgaaagaaaatgcaa
gtgtgcatgcaaaaacatgctgctgtctttagaattggacccctcctagaagaaggctac
aaacagatactcaccatctgctcccagtttaatgatgtctacgttaaggacaaaacgctg
acttggaacacagatttgatcgaaacgctggagctggaaaatttactaacgttggcttct
caaaccattttagccgccatagagcgaaaggagtccaggggagcgcatgcaagggatgac
ttccccgagcgagacgataaggcctttcttaaacactccctaacttggatgactgaccgg
gacgttgagaaggcgaagtttttcaccacctacaggggcgtcatcacgaagccgctggat
gacgagatggagcacgtccccccggtcaaaagggtttactga

DBGET integrated database retrieval system