KEGG   Plasmodium vivax: PVX_113890Help
Entry
PVX_113890        CDS       T01073                                 

Definition
(RefSeq) enoyl-acyl carrier protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pvx  Plasmodium vivax
Pathway
pvx00061  Fatty acid biosynthesis
pvx00780  Biotin metabolism
pvx01100  Metabolic pathways
pvx01130  Biosynthesis of antibiotics
pvx01212  Fatty acid metabolism
Module
pvx_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pvx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PVX_113890
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PVX_113890
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PVX_113890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pvx01004]
    PVX_113890
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PVX_113890
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PVX_113890
Lipid biosynthesis proteins [BR:pvx01004]
 Fatty acid synthase
  Component type
   PVX_113890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short MGAT2
Motif
Other DBs
NCBI-GeneID: 5475465
NCBI-ProteinID: XP_001616166
UniProt: A0A1G4HFM4 A5K1Y9
LinkDB All DBs
Position
11
AA seq 403 aa AA seqDB search
MMMHVRRVVQLATLLLYIASVSAMLRSALKGGGQPKWEIERRGNSREMQFITSKAIKGVA
HKRKISQHSSPAEHMVSEQSGQAEGINGKGEPLGDICFIAGVGDTNGYGWGIAKELSKKN
VKIILGVWPPVYNIFMKNLQSGKFDSDMIIGEGKKMELLDILPFDAAFDSASDVDEETRK
NKRYASLDSYSIEEVANLVYKKYGKINMLVHSLANGREVERSLLETSRGGYLDALSKSSY
SLIALCKHFCKIMHPQSSVISLSYYASQKVVPGYGGGMSSAKAALESDTRTLAYHLGRKH
KIRVNTISAGPLKSRAATAIKKATPQSGGNEGEKKNLAFIDYAIDYSEKYAPLQQKLYST
DVGAVAAFLLSKESRAVTGQTIYVDNGLNIMFGPDDLFQGGAA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcacgtgagaagagtggtccagttggcgaccctactgctgtacatcgcctct
gtcagcgcgatgctgaggagtgccttgaaggggggcggacaacccaagtgggaaatcgaa
aggagagggaactcccgggaaatgcagttcattaccagcaaagcaataaagggggtagct
cataagaggaaaatctcacaacattcatcccctgcagaacacatggtgagtgagcaaagt
gggcaagcggaagggataaatggaaagggagaaccccttggagacatctgcttcatcgcg
ggagtgggagacaccaatggatacgggtggggaatcgcaaaagaattgagcaaaaaaaat
gtaaaaataattctaggcgtatggccaccagtgtataacattttcatgaagaacctccaa
agtggcaaatttgatagcgacatgataattggagaaggtaaaaaaatggagcttctagac
atcctccccttcgacgccgcgtttgattctgccagcgatgtagacgaggaaacgaggaag
aacaaaagatacgccagcttagatagctattccattgaggaggttgccaatttggtatat
aaaaaatatggaaagataaacatgctagttcattcactggctaatgggagagaagtggag
aggagtctacttgagaccagtcgaggtggctatctggacgccctcagcaaaagctcctat
tctctcatagccctatgcaaacatttctgcaaaattatgcacccccaatcgagtgtaata
tccttgagttactacgctagtcagaaggtggtgcctgggtatgggggaggcatgtcaagt
gctaaggcagccttggagtccgacacgagaactttagcctaccacctggggagaaaacac
aaaattagggttaataccatcagcgcggggccactcaaatccagggctgcaactgccatc
aagaaagccactccccaatccgggggaaacgaaggggaaaagaaaaacttggcgtttata
gattacgccattgattactcagaaaaatatgcgcctcttcagcagaagctttattccacg
gacgtcggggccgtggccgcctttttgctgtccaaggagagtagggcggtcactggccag
accatctacgtggacaacgggctcaacatcatgttcggccccgatgacttgtttcaggga
ggggcggcctag

DBGET integrated database retrieval system