KEGG   Plasmodium vivax: PVX_123345Help
Entry
PVX_123345        CDS       T01073                                 

Definition
(RefSeq) iron-sulfur subunit of succinate dehydrogenase, putative
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pvx  Plasmodium vivax
Pathway
pvx00020  Citrate cycle (TCA cycle)
pvx00190  Oxidative phosphorylation
pvx01100  Metabolic pathways
pvx01110  Biosynthesis of secondary metabolites
pvx01130  Biosynthesis of antibiotics
pvx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PVX_123345
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PVX_123345
Enzymes [BR:pvx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PVX_123345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18 Fer4_9 Fer4_22
Motif
Other DBs
NCBI-GeneID: 5476539
NCBI-ProteinID: XP_001617230
UniProt: A5JZU2
LinkDB All DBs
Position
14
AA seq 340 aa AA seqDB search
MTRVTCVANMTRITRMTRAMGTVGTVGRSAPKRAADTHDYKQWTFSNKRRFMSTAQNTAM
NQVTEKNESVKKKSDHAENSAQQNELKKFSIFRYNPQNNKRPKMETFEVDIDNCGPMVLD
VLIKIKDEIDSTLSFRRSCREGICGSCAMNINGKNGLACLTEVNKDKKEVTEIHPLPNLY
IIKDLVPDLTNFYNQYKSIDPWLKRKTKKEKGQKEFYQSIEDRKKLDGLYECIMCASCST
SCPSYWWNPEYYLGPATLMQAYRWIVDSRDEYTKERLMEVNDTMKLYRCHGIMNCTLCCP
KGLDPAKAIRNMKELVQEKFSKESIKSHANYVKEKMEKTK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgagggtgacatgtgtagccaacatgacaaggataacacgcatgacgcgagcaatg
ggaaccgttgggacggtggggaggagcgcccccaagcgagcagcagacacgcacgactat
aaacagtggacattctcaaacaaaagacgattcatgtcaaccgcgcaaaacacagccatg
aaccaagtcacagagaaaaacgaatctgtaaaaaaaaaatccgatcatgctgaaaatagc
gcacaacaaaatgaactgaagaaattttccatttttcgatacaacccacagaataataaa
agacccaaaatggaaacatttgaagtagatatagataactgcggaccgatggttttagat
gtcctgattaagataaaagatgaaatagattctacgttatccttcaggaggagttgtcgt
gagggtatctgtggcagttgcgctatgaacataaatgggaaaaacggcttggcctgttta
actgaagtaaataaagacaaaaaggaagtcaccgaaattcatcccctgcccaatttgtac
attataaaagacctagtcccagatttaacaaatttttataatcagtataaatctattgat
ccttggttaaaaagaaaaacgaaaaaagaaaaagggcagaaagaattttaccaatctatt
gaggataggaaaaaattagatggcctttacgaatgcattatgtgtgcatcttgctccact
tcgtgtccgtcttattggtggaacccggaatattatttaggccctgccacgttaatgcaa
gcctatcgatggattgtcgacagtagggatgaatatacaaaagaacgtctgatggaagtt
aatgacacgatgaagttgtacagatgccatggcatcatgaattgtaccctttgctgcccg
aagggcctggacccagccaaagccatcagaaatatgaaagagttggtgcaggaaaaattt
tccaaggaaagcataaaatcgcacgcgaattatgtgaaggaaaagatggagaaaacgaag
tag

DBGET integrated database retrieval system