KEGG   Pectobacterium parmentieri WPP163: Pecwa_0065Help
Entry
Pecwa_0065        CDS       T01106                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00053  Ascorbate and aldarate metabolism
pwa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Pecwa_0065
Enzymes [BR:pwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     Pecwa_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 3HCDH_N Sacchrp_dh_NADP FAD_binding_3 HI0933_like TrkA_N NAD_binding_7 AdoHcyase_NAD UDPG_MGDP_dh_N Pyr_redox Thi4 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACX85933
LinkDB All DBs
Position
complement(70536..71558)
Genome map
AA seq 340 aa AA seqDB search
MSTMNTLICQEPKKLVWKKREIPIPGESETLIKIKSVGICGTDIHAWGGNQPFFSYPRVL
GHEICGEIVDTGKNVHQFKKGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGF
SEYLAVPATNVLLAEGIDPQAAALIEPYAISAHAVRRAKVQRGEQVLVVGAGPIGLGAAA
IAKADGAQVVVADTSAARREHVIANLNLPVVDPSAEDFEAQLRAEFGGALAEKVIDATGN
QHAMNNTINLIRHGGSIVFVGLFKGDLQFSDPEFHKKETTMMGSRNATPEDFAKVGRLMS
EGKLTAEMMLTHRYPFATLADIYEKDVINNRELIKGVITF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaatgaatacattgatttgccaggaaccaaaaaaacttgtctggaaaaaacgt
gaaatacctattccgggtgagagtgaaacattaattaaaattaagtctgtgggtatttgt
ggaaccgatattcatgcctggggagggaatcaacccttttttagctacccacgcgtatta
ggtcacgaaatatgtggtgagattgtcgatacaggcaaaaacgtacatcaatttaaaaaa
ggccagcaggttgccgtcattccctacgtagcctgtcagcaatgccctgcctgcaagagc
ggccgtaccaactgctgcgagaaaatttcagtcattggtgtacatcaggatggcggattc
agcgaatatctggctgtgcccgccacaaacgtactgcttgcagaagggatcgatccacaa
gcggcggcattaatcgagccctacgccattagcgcgcatgccgttcgccgggcgaaagtg
caacgtggcgaacaggtgctggtcgtcggtgctggccccattggcctcggcgcagcggcc
atcgccaaagcagacggcgctcaggtggtggttgcagataccagcgctgcccgccgcgaa
catgtcattgccaacctgaatctgccggtcgtcgatccctctgccgaggactttgaggct
cagctacgcgccgaatttggtggtgcattggcagaaaaagtgattgatgccacgggaaac
cagcatgcgatgaacaacaccattaacctgatccgccacggtggcagcatcgtgtttgtc
ggtctgtttaaaggtgatttgcagttctccgaccctgaattccataagaaagaaaccacg
atgatgggcagccgtaacgccacaccggaagatttcgccaaagtgggccgtctgatgtct
gaaggcaaactcaccgcagaaatgatgctgacgcaccgttacccctttgccacattggct
gacatctatgaaaaggatgtcattaacaaccgtgagctgatcaaaggcgtcatcacattc
tga

DBGET integrated database retrieval system