KEGG   Pectobacterium parmentieri WPP163: Pecwa_0203Help
Entry
Pecwa_0203        CDS       T01106                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pwa  Pectobacterium parmentieri WPP163
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pwa03012]
    Pecwa_0203
   03029 Mitochondrial biogenesis [BR:pwa03029]
    Pecwa_0203
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pwa04147]
    Pecwa_0203
Translation factors [BR:pwa03012]
 Eukaryotic Type
  Elongation factors
   Pecwa_0203
 Prokaryotic Type
   Pecwa_0203
Mitochondrial biogenesis [BR:pwa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Pecwa_0203
Exosome [BR:pwa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Pecwa_0203
  Exosomal proteins of breast cancer cells
   Pecwa_0203
  Exosomal proteins of colorectal cancer cells
   Pecwa_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ACX86058
UniProt: D0KAT0
LinkDB All DBs
Position
225620..226804
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIVELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggtaacgcacgtgcattcgaccagatcgataacgcaccagaagaaaaagcacgtggt
atcaccatcaacacgtctcacgttgaatacgataccccgtctcgccactatgcgcacgtt
gactgcccaggacacgccgactatgtgaaaaacatgatcaccggtgctgcccagatggat
ggcgcgatcctggttgttgctgcaactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggccgtcaggttggcgttcctttcatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagaactgctggagctggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccaggcgacgacacgccggtaattcgtggttcagcgctgaaagcgctggaa
ggcgaagctgagtgggaagctaaaattgtcgaactggcaggctacctggattcttatatt
ccagaaccagagcgtgcaattgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtactgttgttaccggtcgtgtagagcgcggtatcgttaaagtcggt
gaagaagttgaaatcgttggtatcaaagatacggcgaaatcgacctgtactggcgtagaa
atgttccgcaaattgctggacgaaggtcgtgcaggggagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagaaatcgagcgtggccaggtactggctaagccgggttcaatcaag
ccgcacacccagtttgaatcagaagtgtatatcctgagcaaagatgaaggcggtcgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgacgtaacgggt
accatcgaactgccagaaggcgtagagatggtcatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccaatcgcaatggacgacggtttgcgtttcgcaatccgtgaaggc
ggccgtactgtaggcgcgggtgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system