KEGG   Pectobacterium parmentieri WPP163: Pecwa_0678
Entry
Pecwa_0678        CDS       T01106                                 

Definition
(GenBank) protein of unknown function DUF1525
Organism
pwa  Pectobacterium parmentieri WPP163
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: ACX86499
LinkDB
Position
718870..719274
AA seq 134 aa
MIRSISVLPAMCFALNAFAGTVIYTDSAHPVSSVSSDIPVIYLDAVSKAEQDLLGQLPTD
AMQAEKQAREIVGSPAFIKQQQQIQDAYQGVIRAWSLGVKKYPAIVFDDRWVVYGTTDVD
LARQHLTNVQEAKP
NT seq 405 nt   +upstreamnt  +downstreamnt
atgataagaagtatcagcgtgctgccggccatgtgttttgctttgaacgcattcgccggt
acggtgatttatactgacagcgcgcaccccgtttcctcagtgtcttcagatatccccgtt
atttatctcgatgcagtttcaaaagcggagcaggacctgcttggtcagttgcccactgac
gctatgcaggctgaaaaacaagctcgtgagattgtgggatcgcctgcctttattaaacaa
cagcagcaaattcaggatgcttaccagggcgttatccgggcatggtcgttgggtgtaaaa
aaatacccggccattgtgtttgatgatcgctgggtagtgtacggtaccaccgacgtcgac
ctggctcgtcaacacctgacgaacgtgcaggaggcgaagccgtga

DBGET integrated database retrieval system