KEGG   Pectobacterium parmentieri WPP163: Pecwa_1936Help
Entry
Pecwa_1936        CDS       T01106                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pwa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pecwa_1936
Enzymes [BR:pwa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Pecwa_1936
Transporters [BR:pwa02000]
 Other Transporters
  Pores ion channels [TC:1]
   Pecwa_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: ACX87716
UniProt: D0KB30
LinkDB All DBs
Position
complement(2101961..2102605)
Genome map
AA seq 214 aa AA seqDB search
MIQIHHLEKSRSTRVTWLLEELGIDYEIVRYARDPKTFSAPASLKQIHPLGKSPVITDGE
LTIAESGAIVEYLIETYGKGKLRPQSGQALLDYRFWLHFAEGSLMPLLVMRLVLAKTESA
PMPFFIRPIARKIVQSIEQAFIVPRLTTQLQFIEQHLSTQGWFAGESLSGADIQMAVPLI
LAKTRLDFSRYPHIQQYIERIENQPSFQRALTQD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatacagattcatcacctcgaaaaatcccgttcgactcgcgtgacctggttgctagaa
gagttgggcattgactatgaaattgttcgctacgcgcgtgacccaaaaacgtttagcgcg
cccgcctcgctcaaacagattcacccgttagggaagtcccccgtcattaccgatggtgaa
ctgacgattgccgaatctggggccattgtggaataccttattgagacttacggcaagggc
aagctccgtccacagagtgggcaagcgctgctggattatcgcttctggctgcattttgct
gaaggttcgctcatgccgctcctggtgatgcgtctggtgttagcgaagacagagtccgcg
ccgatgccgtttttcatccgccccatagcccgcaaaattgtgcaaagtatcgagcaagcc
tttattgttcctcgcctgacgacgcaacttcagttcatcgaacaacatttgagtacacaa
ggttggtttgcaggagagtcgctcagcggggccgatatacaaatggcagttccgttgatt
ttggcgaagacgcgtctggacttcagccgttatccccatatccaacaatacattgagcgg
atagaaaaccagccaagttttcaacgggctctgactcaggattaa

DBGET integrated database retrieval system