KEGG   Pectobacterium parmentieri WPP163: Pecwa_2644Help
Entry
Pecwa_2644        CDS       T01106                                 

Definition
(GenBank) Xylose isomerase domain protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00040  Pentose and glucuronate interconversions
pwa00051  Fructose and mannose metabolism
pwa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pecwa_2644
   00051 Fructose and mannose metabolism
    Pecwa_2644
Enzymes [BR:pwa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Pecwa_2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACX88400
UniProt: D0KFY0
LinkDB All DBs
Position
complement(2892272..2893270)
Genome map
AA seq 332 aa AA seqDB search
MATYTYPEFGAGLWHFANYIDRYAVDGYGPALSTIDQIKAAKEVGELSYVDLPYPFTPGV
TLSEVKDALKDAGLKAIGITPEIYLQKWSRGAFTNPDPAARAAAFELMHESAGIVRELGA
NYVKVWPGQDGWDYPFQVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIIDRGRLFGMDVNDNLRGWDDD
LVVGTVHMTEIFEFFYVLKINNWQGVWQLDQFPFRENHVEAAQLSIRFLKHIYRALDKLD
IPALQAAQEAQNPLQAQRIVQDALLSSINVSE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtatacctaccctgaatttggtgccggtttgtggcattttgcgaattatatt
gaccgctacgcggtggacggctacggcccggctttgagtacgatcgatcagatcaaagca
gcaaaagaggtcggagagctttcctacgtcgatctgccttatcccttcacgccgggcgtc
acactcagcgaagtgaaggatgcgctgaaggatgcgggtctgaaagcgattggcatcaca
ccggaaatttacctgcaaaagtggtcgcgtggcgctttcaccaatcccgatccggccgcg
cgggctgcggcgtttgaactgatgcatgaatctgctggcattgtgcgtgaactgggagcg
aattacgtcaaagtctggccggggcaggatggctgggattatccattccaggtcagccat
aaaaacctgtggaagctggcggttgatggtatgcgcgatctcgctggcgctaacccggat
gtgaaattcgccatcgaatacaagccgcgcgaaccgcgtgtgaaaatgacctgggattcc
gcagcgcgaacgctgctggggattgaagatatcgggttagataacgttggcgtgctactg
gacttcggccatgcgctgtatggcggtgaatcaccagcggattctgcccagttgattatc
gatcgcggtcggctgttcggcatggatgtgaatgacaatctgcgcggttgggatgatgat
ttggtggtcggtacggtgcacatgaccgagattttcgagtttttctacgtgctgaaaatc
aacaattggcagggcgtgtggcagctcgatcagttcccgttccgtgagaatcacgtcgag
gcggcgcaactgtctattcgtttcttgaagcatatctatcgtgcgctggataaactggat
attccggcgcttcaggcggcacaggaagcgcaaaacccgttacaggctcagcggattgta
caggacgcgctgctgtcatccattaacgttagcgagtag

DBGET integrated database retrieval system