KEGG   Pectobacterium parmentieri WPP163: Pecwa_3102Help
Entry
Pecwa_3102        CDS       T01106                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00020  Citrate cycle (TCA cycle)
pwa00190  Oxidative phosphorylation
pwa00650  Butanoate metabolism
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
Module
pwa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pwa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pwa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pecwa_3102
   00650 Butanoate metabolism
    Pecwa_3102
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Pecwa_3102
Enzymes [BR:pwa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Pecwa_3102
    1.3.5.4  fumarate reductase (quinol)
     Pecwa_3102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like FAD_oxidored BEX Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACX88844
LinkDB All DBs
Position
complement(3381902..3383668)
Genome map
AA seq 588 aa AA seqDB search
MNLPVREFDAVVVGAGGAGMRAALQISQMGQSCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGSIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TAICIETGEVVYFKAKATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPLQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCEGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVSGQALTVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRSAGLHLK
ESLEEQGESRDASESDIEASLDRMNRWNNTRSGEDPVEIRKALQSCMQNNFSVFREGDAM
AKGLEELKVIRERLKDARLDDTSSEFNTQRIECLELDNLMETAYATAVSANFRTESRGAH
SRFDYPERDDENWLCHSLYLPQTDSMTRREVNMQPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgccagtcagagaatttgatgcagtggttgtgggtgcgggtggcgcaggtatg
cgtgccgcgctacaaatctcccaaatgggccagtcctgtgccctattatcgaaagtgttc
ccaacccgttctcatactgtatctgcgcagggcggtattaccgtcgcgttgggtaatacc
catgaggataactgggaatggcatatgtatgacaccgtcaaagggtcggattacattggc
gatcaggacgcgattgaatatatgtgtaaaaccggcccggaagcgattctggaactggaa
cacatggggctaccgttctcccgtctggatgatggcagcatttatcagcgtccgttcggt
ggtcaatccaagaattttggcggtgagcaggctgcacgtactgccgcagccgctgaccgt
accggccatgcgctgctgcacacgctgtatcagcagaacctgaaaaatcacaccactatt
ttctccgagtggtatgccctcgatctggtgaaaaatcaggatggcgcggttgtcggctgt
acggcgatctgtatcgaaaccggtgaagttgtctatttcaaagcgaaagcaaccgtgctg
gcaaccggcggcgcgggccgtatctaccagtccaccaccaatgcgcacattaataccggc
gacggcgtgggcatggcattgcgtgccggtgttccgttgcaggacatggaaatgtggcag
ttccacccaacgggtattgctggtgcgggtgtgctggtcaccgaaggctgtcgtggtgaa
ggcggctatttgctgaataagcacggtgagcgtttcatggaacgctatgcgccaaacgcg
aaagatctggccggtcgtgatgtggttgctcgttctattatgatcgagattcgtgaaggc
cgtggctgtgagggtccatgggggccgcacgccaagctgaagttggatcatctgggtaaa
gacgttctggaatctcgtctgccgggtattttggaactgtcccgcacgtttgctcacgtc
gatccggtaaaagaaccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagtgagcggtcaggcgttgacggtaaacgagaaaggcgaagatgtggtgatc
cctgggctgttcgccgtgggtgaaattgcctgcgtatcggttcatggtgccaaccgtctg
ggcggtaactcgttgctcgacctggtggtattcggtcgctctgccggacttcacctgaaa
gaatctctggaagagcagggcgaaagccgtgatgccagcgaatccgatattgaagcgtcg
ctcgaccgtatgaatcgttggaacaatacccgttccggtgaagatccggttgaaatccgc
aaggcgctgcaatcctgcatgcagaataacttctcggtattccgtgaaggcgatgcgatg
gcgaaagggttggaagagctgaaagtgatccgtgagcgcctgaaagacgcacgtctggat
gacacctcaagcgagttcaacacccagcgcattgagtgtctggaattggataacctgatg
gaaacggcttatgcaacagcggtttcggctaacttccgtaccgaaagtcgtggggcgcat
agtcgcttcgattacccagagcgtgacgatgaaaattggttgtgccattcgttgtatctg
ccgcaaaccgacagcatgacgcgccgtgaggtgaacatgcagcctaaattgcgtccggcg
ttcccgccgaaaatacgtacttattaa

DBGET integrated database retrieval system