KEGG   Pectobacterium parmentieri WPP163: Pecwa_3153Help
Entry
Pecwa_3153        CDS       T01106                                 

Definition
(GenBank) Beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00550  Peptidoglycan biosynthesis
pwa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pecwa_3153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pwa01002]
    Pecwa_3153
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pwa01011]
    Pecwa_3153
Enzymes [BR:pwa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Pecwa_3153
Peptidases and inhibitors [BR:pwa01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Pecwa_3153
Peptidoglycan biosynthesis and degradation proteins [BR:pwa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Pecwa_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACX88895
LinkDB All DBs
Position
3438493..3439704
Genome map
AA seq 403 aa AA seqDB search
MNTVNTSRFTKRTALGALLVISASSFAYAEDINLKTMIPGVPQIDAESYILIDYNSGKVL
AEMNADTRRDPASLTKMMTSYVIGQAIKSGKISPNDIVTVGKDAWATGNPTFQGSSLMFL
KPGDRVPVSQLNRGIILQSGNDACVAMADYVAGSQDAFVNLMNGYVKALGLQNTNFETVH
GLDAPGQFSSARDMALIGQALIRDVPEEYATYKEKEFTFNNIRQPNRNGLLWDSSLNVDG
IKTGHTSSAGFNLVASATEGQMRLISAVLGGRNAKGRESESKKLLTWGFRFFETVAPLKA
GKEFASEPVWFGDSDRVALGVEKDAYLTIPRGRMKDLKASYVLDNTELHAPLAKNQVVGS
INFQLDGKTIDQRPLVVMNEVKEGGIFGRMIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgtaaacacgtctcgttttactaagcgtactgcgcttggcgcactgctcgtc
attagtgcctcttcctttgcctatgccgaagatatcaatcttaaaacgatgatccccggc
gtcccgcaaatcgatgctgaatcctacatcctgattgattacaactctgggaaagtgttg
gcggaaatgaatgccgacacacgccgcgatccggccagcttaacgaaaatgatgaccagc
tacgttattggtcaggcgattaaatcaggaaaaatcagcccgaacgacatcgttaccgtc
ggtaaagatgcctgggcaaccggcaacccgaccttccaggggtcttccctgatgttcctg
aagccaggcgaccgtgttcctgtttcccaactcaatcgcggcattatcctgcaatccggt
aacgatgcctgcgtcgcgatggccgactacgttgctggcagtcaggatgctttcgttaac
ctgatgaacggttacgtgaaagcgctggggctgcaaaacaccaattttgaaactgtgcac
ggtcttgatgcgccgggtcagttcagttcggcgcgtgatatggctttgatcggtcaggcg
ctgatccgcgatgttccagaagagtatgcaacctacaaagagaaagagttcacattcaac
aatatccgccagcctaaccgtaacggcttgctgtgggattccagcctgaatgttgacggc
atcaaaacgggccatacgtcatcagccggcttcaatctggtcgcctcagcaacagaaggt
cagatgcgcctgatttcagcggtactgggtggacgtaatgccaaagggcgcgagtcagaa
agtaaaaaattgctgacctggggcttccgcttctttgaaaccgtcgcgccgttaaaagcc
ggtaaagaattcgcctctgagccagtctggtttggcgacagtgaccgcgttgcattaggc
gtagagaaagatgcctacctgaccataccgcgcggccgcatgaaagatctgaaagccagc
tacgttctggacaacacggaactgcacgcaccgttagccaaaaatcaggttgtgggctcc
atcaacttccagttggatggcaaaaccatcgatcagcgcccgctggtcgtcatgaacgaa
gtgaaagaaggcgggatctttggccgtatgatcgattacatcaaactgatgttccaccat
tggttcggctaa

DBGET integrated database retrieval system