KEGG   Pectobacterium parmentieri WPP163: Pecwa_4234Help
Entry
Pecwa_4234        CDS       T01106                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pwa  Pectobacterium parmentieri WPP163
Pathway
pwa00071  Fatty acid degradation
pwa00280  Valine, leucine and isoleucine degradation
pwa00281  Geraniol degradation
pwa00310  Lysine degradation
pwa00362  Benzoate degradation
pwa00380  Tryptophan metabolism
pwa00410  beta-Alanine metabolism
pwa00640  Propanoate metabolism
pwa00650  Butanoate metabolism
pwa00903  Limonene and pinene degradation
pwa00930  Caprolactam degradation
pwa01100  Metabolic pathways
pwa01110  Biosynthesis of secondary metabolites
pwa01120  Microbial metabolism in diverse environments
pwa01130  Biosynthesis of antibiotics
pwa01200  Carbon metabolism
pwa01212  Fatty acid metabolism
Module
pwa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Pecwa_4234
   00650 Butanoate metabolism
    Pecwa_4234
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pecwa_4234
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pecwa_4234
   00310 Lysine degradation
    Pecwa_4234
   00380 Tryptophan metabolism
    Pecwa_4234
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pecwa_4234
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pecwa_4234
   00281 Geraniol degradation
    Pecwa_4234
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pecwa_4234
   00930 Caprolactam degradation
    Pecwa_4234
Enzymes [BR:pwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pecwa_4234
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pecwa_4234
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pecwa_4234
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Pecwa_4234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Osmo_MPGsynth
Motif
Other DBs
NCBI-ProteinID: ACX89958
LinkDB All DBs
Position
4677648..4679837
Genome map
AA seq 729 aa AA seqDB search
MLYQGESLYLNWLEDGIAELVFSAQGSVNTLDTRTVASLGKALDVLAEQPNLKGLLLRSD
KPAFIVGADITEFLSLFAAPAEKLHEWLAFANRIFNRLEDLSVPTLSAINSYALGGGCEC
VLATDFRLATPDARIGLPETKLGIMPGFGGTVRLPRLLGADSALEIIAAGKDVSAVDALK
VGLVQAVVANEKLIPAAIKMLKQAINGELDWQAYRRPKLEALKLSKIEAMMSFTTAKAMV
LQTAGKHYPAPMLAVKTIEAAATMTRDDALQLETQHFVQLARSNEARALVGIFLNDQYVK
GKAKKLIGETSVPQQAAVLGAGIMGGGIAYQSAFKGVPIRMKDISEKPLALGMNEAAKLL
NKQMERGKLDGMKMAAILASIQPTLDYAGFERTDIVVEAVVENPKIKASVLAETESHISE
STILASNTSTIPITTLAASLERPQNFCGMHFFNPVHRMPLVEIIRGPKTSDSTIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAAFSLLLRDGADFRDIDNVMEKKFGWPMGPAYL
LDVVGIDTAHHAQTVMAEGFPQRMAKDYRDAIDVLFEHQRFGQKNGQGFYRYQTDGKGKQ
RKERDDAVDTLLKDISQPKKTFSAEEIIARMMIPMINEVARCLEEDIVASPAEADMALVY
GLGFPPFHGGACRYLDTLGSERYVEMAQSLAHLGTIYQVPDGLQQKARSNEGYYPSVAPH
ADISHGQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcaaggtgaatccctctaccttaactggcttgaggacggcattgccgagctg
gtattttctgcccagggctccgtaaacacactagatacacgcacggttgccagcctaggt
aaagcgctcgacgttctggcggaacagccgaacctgaagggcttactgctgcgttcggat
aaacctgcatttattgtcggggccgatatcacggaattcctttctctttttgccgcacca
gccgaaaaactgcatgagtggctggccttcgccaaccgtattttcaaccgccttgaggat
ttatccgttcccacactgtccgcgattaatagctatgcgttgggtggcggctgtgaatgc
gtgctggcgaccgattttcgcttagccacaccggatgcacgtatcggcttgcccgaaact
aaactcgggatcatgccgggttttggtggcacggtcaggctaccacgtctgctgggtgct
gatagcgcgctggagattatcgccgcaggtaaagacgtcagcgcggtcgatgctttaaaa
gtggggctggtgcaggccgttgtcgcgaatgaaaaactgattcccgccgctatcaaaatg
ctaaaacaggctataaatggcgaattagactggcaggcttatcggcgcccaaaacttgag
gcgctgaagctcagtaaaattgaagctatgatgagctttaccaccgccaaagcgatggtg
ctgcaaaccgccgggaaacattatccggcaccgatgttagcggtaaaaaccatcgaagcc
gccgcaaccatgacgcgagatgacgccttgcagctcgaaacgcagcacttcgttcaactg
gctcgctcaaatgaagcccgcgccctcgtcggtattttcctcaacgatcaatatgttaaa
ggcaaagcgaagaagctgatcggcgagacatctgtgccacagcaggccgccgtactaggt
gcaggaattatgggcggcggaattgcctatcagtccgcgttcaaaggcgtgccgattcgg
atgaaagacatcagcgagaaaccgctcgcactggggatgaatgaagcagccaaactcctg
aataagcagatggaacgaggcaagctggacggaatgaaaatggcggcgattctggccagt
attcagccaacgctggattacgccgggttcgagcgtaccgatatcgtggttgaagccgtg
gtagaaaacccgaaaatcaaagccagcgtattagcagaaaccgaatcgcacattagcgaa
agtacgattctggcttcgaatacctcaacgattcccattactacactggctgcttcgtta
gaacgaccacaaaatttctgcggtatgcacttcttcaacccagtacaccgcatgccgctg
gttgaaatcattcgcggccccaaaaccagtgacagcaccatcgccagcgtggtggcttac
gccagcaaaatgggcaagacaccgattgtcgtgaacgactgccccggattcttcgtgaat
cgcgtcctatttccctactttgcggcattcagcttattgctcagagacggtgccgatttc
cgcgatatcgataatgtcatggagaaaaaattcggttggccgatgggccctgcttatctg
cttgacgttgtcggtattgataccgctcaccatgctcagaccgtgatggctgagggcttc
ccacagcgcatggcgaaagactatcgcgatgcgattgatgtgctgtttgaacaccaacgt
ttcgggcagaagaatggtcaaggcttctaccgttatcaaacggatggcaaggggaaacag
cgtaaagagcgagatgacgccgtagatacgctccttaaagacatcagccaaccgaaaaaa
actttcagtgcagaagagattatcgctcgcatgatgatcccgatgattaatgaagtcgcg
cgttgcctggaagaagacatcgttgccagtccggccgaagcagacatggcgctggtatac
gggctaggttttcctcccttccacggcggagcctgccgttatctggataccttgggcagc
gaacgttatgtcgaaatggcgcagtcgttggcacacctcggcaccatctatcaggtgcca
gacggcttacagcaaaaagccagaagcaatgaaggctattacccatcggtcgcgccacac
gcggacatttcccacggacaaccggcatga

DBGET integrated database retrieval system